Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100920
Name   oriT_pECAZ155_KPC in_silico
Organism   Escherichia coli strain Ecol_AZ155
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP019001 (176415..176965 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pECAZ155_KPC
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   991 GenBank   WP_013362805
Name   TraI_pECAZ155_KPC insolico UniProt ID   _
Length   1706 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1706 a.a.        Molecular weight: 186742.95 Da        Isoelectric Point: 5.9554

>WP_013362805.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIRETVGEDASLKSRDVAALDTRKSKQHVDPEIKMTEWMQT
LKETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGMFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELAMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKYAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVEKALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRE
TERRADEIVRKMAENKPDLPDGKTELAVRDIAGQERDRTATSERETALPESVLRESQREREAVREVAREN
LLQRLLQQMERDMVRDLQKEKTLGGD

  Protein domains


Predicted by InterproScan.

TrwC relaxase (TrwC)

(10-283)

AAA domain (AAA_30)

(968-1156)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

DNA helicase TraI (TraI_C)

(1434-1557)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 19930..46307

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE948_RS27305 (BE948_00140) 15614..15802 - 189 WP_001299721 hypothetical protein -
BE948_RS00145 15859..17228 + 1370 WP_085947770 IS3-like element IS150 family transposase -
BE948_RS28020 17270..17419 + 150 Protein_26 plasmid maintenance protein Mok -
BE948_RS00150 (BE948_00155) 17361..17486 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
BE948_RS28025 (BE948_00160) 17706..17936 + 231 WP_071886920 hypothetical protein -
BE948_RS28030 17934..18106 - 173 Protein_29 hypothetical protein -
BE948_RS28035 (BE948_00170) 18176..18382 + 207 WP_000547968 hypothetical protein -
BE948_RS00170 (BE948_00175) 18407..18694 + 288 WP_000107535 hypothetical protein -
BE948_RS00175 (BE948_00180) 18812..19633 + 822 WP_001234426 DUF932 domain-containing protein -
BE948_RS00180 (BE948_00185) 19930..20520 - 591 WP_192849409 transglycosylase SLT domain-containing protein virB1
BE948_RS00185 (BE948_00190) 20853..21236 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
BE948_RS00190 (BE948_00195) 21423..22112 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
BE948_RS00195 (BE948_00200) 22211..22606 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
BE948_RS00200 (BE948_00205) 22639..23004 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
BE948_RS00205 (BE948_00210) 23019..23330 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
BE948_RS00210 (BE948_00215) 23352..23918 + 567 WP_021514868 type IV conjugative transfer system protein TraE traE
BE948_RS00215 (BE948_00220) 23905..24633 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
BE948_RS00220 (BE948_00225) 24633..26060 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
BE948_RS00225 (BE948_00230) 26050..26640 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
BE948_RS00230 (BE948_00235) 26627..26824 + 198 WP_001324648 conjugal transfer protein TrbD -
BE948_RS00235 (BE948_00240) 26836..27087 + 252 WP_001038342 conjugal transfer protein TrbG -
BE948_RS00240 (BE948_00245) 27084..27599 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
BE948_RS00245 (BE948_00250) 27734..27955 + 222 WP_001278689 conjugal transfer protein TraR -
BE948_RS00250 (BE948_00255) 28115..30742 + 2628 WP_001064245 type IV secretion system protein TraC virb4
BE948_RS00255 (BE948_00260) 30739..31125 + 387 WP_000099686 type-F conjugative transfer system protein TrbI -
BE948_RS00260 (BE948_00265) 31122..31754 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
BE948_RS00265 (BE948_00270) 31751..32743 + 993 WP_000830180 conjugal transfer pilus assembly protein TraU traU
BE948_RS00270 (BE948_00275) 32752..33390 + 639 WP_021518374 type-F conjugative transfer system pilin assembly protein TrbC trbC
BE948_RS00275 (BE948_00280) 33387..35195 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BE948_RS00280 (BE948_00285) 35222..35479 + 258 WP_000864312 conjugal transfer protein TrbE -
BE948_RS00285 (BE948_00290) 35472..36215 + 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
BE948_RS00290 (BE948_00295) 36229..36570 + 342 WP_000556794 conjugal transfer protein TrbA -
BE948_RS00295 (BE948_00300) 36551..36886 - 336 WP_000415571 hypothetical protein -
BE948_RS00300 (BE948_00305) 36967..37251 + 285 WP_000624105 type-F conjugative transfer system pilin chaperone TraQ -
BE948_RS00305 (BE948_00310) 37238..37792 + 555 WP_001553830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BE948_RS00310 (BE948_00315) 37782..38096 + 315 WP_023149603 P-type conjugative transfer protein TrbJ -
BE948_RS00315 (BE948_00320) 38050..38442 + 393 WP_000164675 F-type conjugal transfer protein TrbF -
BE948_RS00320 (BE948_00325) 38429..39802 + 1374 WP_021518370 conjugal transfer pilus assembly protein TraH traH
BE948_RS00325 (BE948_00330) 39799..42624 + 2826 WP_001553826 conjugal transfer mating-pair stabilization protein TraG traG
BE948_RS00330 (BE948_00335) 42621..43130 + 510 WP_000628100 conjugal transfer entry exclusion protein TraS -
BE948_RS00335 (BE948_00340) 43144..43875 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
BE948_RS00340 (BE948_00345) 44127..46307 + 2181 WP_013362804 type IV conjugative transfer system coupling protein TraD virb4

Region 2: 174549..183639

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE948_RS01230 (BE948_01265) 170580..170813 - 234 WP_001191892 hypothetical protein -
BE948_RS01235 (BE948_01270) 170795..171412 - 618 WP_001249396 hypothetical protein -
BE948_RS01240 (BE948_01275) 171580..174552 + 2973 WP_064986968 MobH family relaxase -
BE948_RS01245 (BE948_01280) 174549..176414 + 1866 WP_000178857 conjugative transfer system coupling protein TraD virb4
BE948_RS01250 (BE948_01285) 176464..177009 + 546 WP_000228720 hypothetical protein -
BE948_RS01255 (BE948_01290) 176966..177595 + 630 WP_000743449 DUF4400 domain-containing protein tfc7
BE948_RS01260 (BE948_01295) 177605..178051 + 447 WP_000122507 hypothetical protein -
BE948_RS01265 (BE948_01300) 178061..178438 + 378 WP_000869297 hypothetical protein -
BE948_RS01270 (BE948_01305) 178438..179100 + 663 WP_001231464 hypothetical protein -
BE948_RS27745 179281..179424 + 144 WP_001275801 hypothetical protein -
BE948_RS01275 (BE948_01310) 179436..179801 + 366 WP_001052530 hypothetical protein -
BE948_RS01280 (BE948_01315) 179946..180227 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
BE948_RS01285 (BE948_01320) 180224..180850 + 627 WP_001049717 TraE/TraK family type IV conjugative transfer system protein traE
BE948_RS01290 (BE948_01325) 180834..181751 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
BE948_RS01295 (BE948_01330) 181751..183064 + 1314 WP_024131605 TraB/VirB10 family protein traB
BE948_RS01300 (BE948_01335) 183061..183639 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
BE948_RS01305 (BE948_01340) 183643..184035 + 393 WP_000479535 TraA family conjugative transfer protein -
BE948_RS01310 (BE948_01345) 184320..185531 + 1212 WP_078207477 IS1380-like element ISEcp1 family transposase -
BE948_RS01325 (BE948_01375) 186683..187828 + 1146 WP_000976514 extended-spectrum class C beta-lactamase CMY-2 -
BE948_RS01330 (BE948_01380) 187922..188455 + 534 WP_001221666 lipocalin family protein -

Host bacterium

ID   1379 GenBank   NZ_CP019001
Plasmid name   pECAZ155_KPC Incompatibility group   IncFIC
Plasmid size   272202 bp Coordinate of oriT [Strand]   176415..176965 [+]
Host baterium   Escherichia coli strain Ecol_AZ155

Cargo genes

Drug resistance gene   tetracycline resistance; resistance to cetylpyridinium; quaternary ammonium compound resistance
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -