Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100919
Name   oriT_pECAZ146_1 in_silico
Organism   Escherichia coli strain Ecol_AZ146
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP018990 (56545..56834 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_pECAZ146_1
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   990 GenBank   WP_013362805
Name   TraI_pECAZ146_1 insolico UniProt ID   E3PYK7
Length   1706 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1706 a.a.        Molecular weight: 186742.95 Da        Isoelectric Point: 5.9554

>WP_013362805.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIRETVGEDASLKSRDVAALDTRKSKQHVDPEIKMTEWMQT
LKETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGMFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELAMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKYAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVEKALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRE
TERRADEIVRKMAENKPDLPDGKTELAVRDIAGQERDRTATSERETALPESVLRESQREREAVREVAREN
LLQRLLQQMERDMVRDLQKEKTLGGD

  Protein domains


Predicted by InterproScan.

TrwC relaxase (TrwC)

(10-283)

AAA domain (AAA_30)

(968-1156)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

DNA helicase TraI (TraI_C)

(1434-1557)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 55983..82387

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE932_RS01280 (BE932_01335) 51438..51671 + 234 WP_000005990 DUF905 family protein -
BE932_RS01285 (BE932_01340) 51699..51896 + 198 Protein_64 hypothetical protein -
BE932_RS01290 (BE932_01345) 51951..52385 + 435 WP_000845937 conjugation system SOS inhibitor PsiB -
BE932_RS01295 (BE932_01350) 52382..53144 + 763 Protein_66 plasmid SOS inhibition protein A -
BE932_RS30595 (BE932_01355) 53113..53301 - 189 WP_001299721 hypothetical protein -
BE932_RS31600 53323..53472 + 150 Protein_68 plasmid maintenance protein Mok -
BE932_RS01300 (BE932_01360) 53414..53539 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
BE932_RS31605 (BE932_01365) 53759..53989 + 231 WP_071886920 hypothetical protein -
BE932_RS31610 53987..54159 - 173 Protein_71 hypothetical protein -
BE932_RS31615 (BE932_01375) 54229..54435 + 207 WP_000547968 hypothetical protein -
BE932_RS01320 (BE932_01380) 54460..54747 + 288 WP_000107535 hypothetical protein -
BE932_RS01325 (BE932_01385) 54865..55686 + 822 WP_001234426 DUF932 domain-containing protein -
BE932_RS01330 (BE932_01390) 55983..56573 - 591 WP_192849409 transglycosylase SLT domain-containing protein virB1
BE932_RS01335 (BE932_01395) 56906..57289 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
BE932_RS01340 (BE932_01400) 57476..58165 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
BE932_RS01345 (BE932_01405) 58264..58659 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
BE932_RS01350 (BE932_01410) 58692..59057 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
BE932_RS01355 (BE932_01415) 59072..59383 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
BE932_RS01360 (BE932_01420) 59405..59971 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
BE932_RS01365 (BE932_01425) 59958..60686 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
BE932_RS01370 (BE932_01430) 60686..62113 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
BE932_RS01375 (BE932_01435) 62103..62693 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
BE932_RS01380 (BE932_01440) 62680..62877 + 198 WP_001324648 conjugal transfer protein TrbD -
BE932_RS01385 (BE932_01445) 62889..63140 + 252 WP_001038342 conjugal transfer protein TrbG -
BE932_RS01390 (BE932_01450) 63137..63652 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
BE932_RS01395 (BE932_01455) 63787..64008 + 222 WP_001278689 conjugal transfer protein TraR -
BE932_RS01400 (BE932_01460) 64168..66795 + 2628 WP_001064245 type IV secretion system protein TraC virb4
BE932_RS01405 (BE932_01465) 66792..67178 + 387 WP_000099686 type-F conjugative transfer system protein TrbI -
BE932_RS01410 (BE932_01470) 67175..67807 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
BE932_RS01415 (BE932_01475) 67804..68796 + 993 WP_000830180 conjugal transfer pilus assembly protein TraU traU
BE932_RS01420 (BE932_01480) 68805..69443 + 639 WP_021518374 type-F conjugative transfer system pilin assembly protein TrbC trbC
BE932_RS01425 (BE932_01485) 69440..71248 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BE932_RS01430 (BE932_01490) 71275..71532 + 258 WP_000864312 conjugal transfer protein TrbE -
BE932_RS01435 (BE932_01495) 71525..72268 + 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
BE932_RS01440 (BE932_01500) 72282..72623 + 342 WP_000556794 conjugal transfer protein TrbA -
BE932_RS01445 (BE932_01505) 72604..72939 - 336 WP_000415571 hypothetical protein -
BE932_RS01450 (BE932_01510) 73020..73304 + 285 WP_000624105 type-F conjugative transfer system pilin chaperone TraQ -
BE932_RS01455 (BE932_01515) 73291..73845 + 555 WP_001553830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BE932_RS01460 (BE932_01520) 73835..74149 + 315 WP_023149603 P-type conjugative transfer protein TrbJ -
BE932_RS01465 (BE932_01525) 74103..74495 + 393 WP_000164675 F-type conjugal transfer protein TrbF -
BE932_RS01470 (BE932_01530) 74482..75855 + 1374 WP_021518370 conjugal transfer pilus assembly protein TraH traH
BE932_RS01475 (BE932_01535) 75852..78677 + 2826 WP_001553826 conjugal transfer mating-pair stabilization protein TraG traG
BE932_RS01480 (BE932_01540) 78674..79183 + 510 WP_000628100 conjugal transfer entry exclusion protein TraS -
BE932_RS01485 (BE932_01545) 79197..79928 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
BE932_RS01490 (BE932_01550) 80180..82387 + 2208 WP_048257129 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   1378 GenBank   NZ_CP018990
Plasmid name   pECAZ146_1 Incompatibility group   IncFIB
Plasmid size   150994 bp Coordinate of oriT [Strand]   56545..56834 [-]
Host baterium   Escherichia coli strain Ecol_AZ146

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -