Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100913
Name   oriT_pEC545_KPC in_silico
Organism   Escherichia coli strain Ecol_545
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018974 (17430..17535 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pEC545_KPC
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   984 GenBank   WP_078207386
Name   PutativerelaxaseofpEC545_KPC insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75218.97 Da        Isoelectric Point: 9.9948

>WP_078207386.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacteriaceae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSENDDKFNPK

  Protein domains


Predicted by InterproScan.

(88-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 20331..47529

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE949_RS00680 (BE949_00710) 15415..15726 + 312 WP_004187333 hypothetical protein -
BE949_RS00685 (BE949_00715) 15859..16395 + 537 WP_004187332 hypothetical protein -
BE949_RS00690 (BE949_00720) 16896..17261 - 366 WP_039592107 hypothetical protein -
BE949_RS28045 17327..17854 + 528 WP_241184337 plasmid mobilization protein MobA -
BE949_RS00700 (BE949_00730) 17841..19820 + 1980 WP_078207386 TraI/MobA(P) family conjugative relaxase -
BE949_RS00705 (BE949_00735) 19834..20334 + 501 WP_004187320 DotD/TraH family lipoprotein -
BE949_RS00710 (BE949_00740) 20331..21110 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BE949_RS00715 (BE949_00745) 21121..22284 + 1164 WP_077138898 plasmid transfer ATPase TraJ virB11
BE949_RS00720 (BE949_00750) 22274..22534 + 261 WP_004187310 IcmT/TraK family protein traK
BE949_RS28050 22559..25816 + 3258 WP_223173498 LPD7 domain-containing protein -
BE949_RS00730 (BE949_00760) 25782..26294 + 513 WP_011091071 hypothetical protein traL
BE949_RS00735 (BE949_00765) 26295..26507 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
BE949_RS00740 (BE949_00770) 26479..26889 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BE949_RS00745 (BE949_00775) 26957..27670 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BE949_RS00750 (BE949_00780) 27679..28830 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BE949_RS00755 (BE949_00785) 28842..30191 + 1350 WP_004187474 conjugal transfer protein TraO traO
BE949_RS00760 (BE949_00790) 30203..30907 + 705 WP_015060002 conjugal transfer protein TraP traP
BE949_RS00765 (BE949_00795) 30931..31461 + 531 WP_004187478 conjugal transfer protein TraQ traQ
BE949_RS00770 (BE949_00800) 31478..31867 + 390 WP_004187479 DUF6750 family protein traR
BE949_RS00775 (BE949_00805) 31913..32407 + 495 WP_004187480 hypothetical protein -
BE949_RS00780 (BE949_00810) 32404..35454 + 3051 WP_078207387 conjugal transfer protein traU
BE949_RS00785 (BE949_00815) 35451..36659 + 1209 WP_011091082 conjugal transfer protein TraW traW
BE949_RS00790 (BE949_00820) 36656..37306 + 651 WP_004187488 hypothetical protein -
BE949_RS00795 (BE949_00825) 37299..39479 + 2181 WP_004187492 DotA/TraY family protein traY
BE949_RS00800 (BE949_00830) 39482..40135 + 654 WP_004206935 hypothetical protein -
BE949_RS00805 (BE949_00835) 40209..40439 + 231 WP_004187496 IncL/M type plasmid replication protein RepC -
BE949_RS00810 (BE949_00840) 40736..41791 + 1056 WP_249534829 plasmid replication initiator RepA -
BE949_RS28295 43015..43110 + 96 WP_004206884 DinQ-like type I toxin DqlB -
BE949_RS00815 (BE949_00845) 43161..45248 - 2088 WP_004187443 hypothetical protein -
BE949_RS00820 (BE949_00850) 45261..46211 - 951 WP_078207389 DsbC family protein trbB
BE949_RS00825 (BE949_00855) 46222..47529 - 1308 WP_015062796 hypothetical protein trbA
BE949_RS00830 (BE949_00860) 47529..47924 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
BE949_RS00835 (BE949_00865) 48029..48379 - 351 WP_004187434 DUF1496 domain-containing protein -
BE949_RS00840 (BE949_00870) 48492..49145 + 654 WP_039592068 type II CAAX endopeptidase family protein -
BE949_RS00845 (BE949_00875) 49299..49538 + 240 Protein_62 S24 family peptidase -
BE949_RS00850 (BE949_00880) 49603..50307 + 705 WP_001067855 IS6-like element IS26 family transposase -
BE949_RS00855 (BE949_00885) 50451..51005 + 555 WP_063840321 fluoroquinolone-acetylating aminoglycoside 6'-N-acetyltransferase AAC(6')-Ib-cr5 -
BE949_RS00860 (BE949_00890) 51136..51966 + 831 WP_001334766 oxacillin-hydrolyzing class D beta-lactamase OXA-1 -


Host bacterium


ID   1372 GenBank   NZ_CP018974
Plasmid name   pEC545_KPC Incompatibility group   IncL/M
Plasmid size   70876 bp Coordinate of oriT [Strand]   17430..17535 [+]
Host baterium   Escherichia coli strain Ecol_545

Cargo genes


Drug resistance gene   aac(6')-Ib-cr, blaOXA-1, catB3, blaKPC-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -