Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100912
Name   oriT_pEC545_3 in_silico
Organism   Escherichia coli strain Ecol_545
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP018973 (63431..63709 [+], 279 nt)
oriT length   279 nt
IRs (inverted repeats)      220..227, 230..237  (GCAAAAAC..GTTTTTGC)
Location of nic site      246..247
Conserved sequence flanking the
  nic site    		  GTAGTGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 279 nt

>oriT_pEC545_3
CGCTAGCAGCGCCCCTGACGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGCTGTAGCTGCGTTAACGACGCTGCTTTAAAAAAATCAGATTTAAACAATATAAATCCACAAATACAACTCAATGATATTAAAGATAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   983 GenBank   WP_000948349
Name   TraI_pEC545_3 insolico UniProt ID   _
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191729.35 Da        Isoelectric Point: 5.7956

>WP_000948349.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQDPQLHTHVVVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEA
LGYETEVVGKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEIRMAEWMQT
LKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMVFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGETFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTELAVRDIAGQERDRSAISERETALPESVLRESQREREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

DNA helicase TraI (TraI_C)

(1434-1557)

TrwC relaxase (TrwC)

(10-283)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

AAA domain (AAA_30)

(968-1156)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 35917..64277

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BE949_RS00285 (BE949_00305) 35917..38169 - 2253 WP_078207383 type IV conjugative transfer system coupling protein TraD virb4
BE949_RS00290 (BE949_00310) 38220..38957 - 738 WP_012881122 hypothetical protein -
BE949_RS00295 (BE949_00315) 39160..39891 - 732 WP_012881123 conjugal transfer complement resistance protein TraT -
BE949_RS00300 (BE949_00320) 39905..40414 - 510 WP_000628111 conjugal transfer entry exclusion protein TraS -
BE949_RS00305 (BE949_00325) 40411..43236 - 2826 WP_012881124 conjugal transfer mating-pair stabilization protein TraG traG
BE949_RS00310 (BE949_00330) 43233..44606 - 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
BE949_RS00315 (BE949_00335) 44593..44985 - 393 WP_000659962 F-type conjugal transfer protein TrbF -
BE949_RS00320 (BE949_00340) 44966..45313 - 348 WP_011666494 P-type conjugative transfer protein TrbJ -
BE949_RS00325 (BE949_00345) 45243..45788 - 546 WP_000059830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BE949_RS00330 (BE949_00350) 45775..46059 - 285 WP_000624107 type-F conjugative transfer system pilin chaperone TraQ -
BE949_RS00335 (BE949_00355) 46140..46475 + 336 WP_000736414 hypothetical protein -
BE949_RS00340 (BE949_00360) 46456..46797 - 342 WP_000556795 conjugal transfer protein TrbA -
BE949_RS00345 (BE949_00365) 46811..47554 - 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
BE949_RS00350 (BE949_00370) 47547..47804 - 258 WP_000864353 conjugal transfer protein TrbE -
BE949_RS00355 (BE949_00375) 47831..49681 - 1851 WP_012881125 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BE949_RS00360 (BE949_00380) 49678..50316 - 639 WP_012881126 type-F conjugative transfer system pilin assembly protein TrbC trbC
BE949_RS00365 (BE949_00385) 50325..50630 - 306 WP_000224418 hypothetical protein -
BE949_RS00370 (BE949_00390) 50660..51652 - 993 WP_000830849 conjugal transfer pilus assembly protein TraU traU
BE949_RS00375 (BE949_00395) 51649..52281 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
BE949_RS00380 (BE949_00400) 52278..52664 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
BE949_RS00385 (BE949_00405) 52661..55291 - 2631 WP_000069772 type IV secretion system protein TraC virb4
BE949_RS27330 (BE949_00410) 55417..55764 - 348 WP_000836682 hypothetical protein -
BE949_RS00395 (BE949_00415) 55792..56010 - 219 WP_000556745 hypothetical protein -
BE949_RS00400 (BE949_00420) 56109..56585 - 477 WP_012881127 hypothetical protein -
BE949_RS00405 (BE949_00425) 56578..56799 - 222 WP_001278683 conjugal transfer protein TraR -
BE949_RS00410 (BE949_00430) 56934..57449 - 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
BE949_RS00415 (BE949_00435) 57446..57766 - 321 WP_012881128 conjugal transfer protein TrbD -
BE949_RS00420 (BE949_00440) 57753..58343 - 591 WP_012881129 conjugal transfer pilus-stabilizing protein TraP -
BE949_RS00425 (BE949_00445) 58333..59760 - 1428 WP_012881130 F-type conjugal transfer pilus assembly protein TraB traB
BE949_RS00430 (BE949_00450) 59760..60488 - 729 WP_001230769 type-F conjugative transfer system secretin TraK traK
BE949_RS00435 (BE949_00455) 60475..61041 - 567 WP_000399780 type IV conjugative transfer system protein TraE traE
BE949_RS00440 (BE949_00460) 61063..61374 - 312 WP_000012100 type IV conjugative transfer system protein TraL traL
BE949_RS00445 (BE949_00465) 61389..61751 - 363 WP_012881131 type IV conjugative transfer system pilin TraA -
BE949_RS00450 (BE949_00470) 61785..62012 - 228 WP_000589556 conjugal transfer relaxosome protein TraY -
BE949_RS00455 (BE949_00475) 62132..62779 - 648 WP_000332523 transcriptional regulator TraJ family protein -
BE949_RS00460 (BE949_00480) 62971..63354 - 384 WP_001151529 conjugal transfer relaxosome DNA-binding protein TraM -
BE949_RS00465 (BE949_00485) 63675..64277 + 603 WP_000243715 transglycosylase SLT domain-containing protein virB1
BE949_RS00470 (BE949_00490) 64573..65394 - 822 WP_001234437 DUF932 domain-containing protein -
BE949_RS00475 (BE949_00495) 65504..65800 - 297 WP_001272251 hypothetical protein -
BE949_RS00490 (BE949_00515) 66271..66531 - 261 WP_071600428 hypothetical protein -
BE949_RS00495 (BE949_00520) 66797..67039 - 243 WP_000540588 hypothetical protein -
BE949_RS00500 (BE949_00525) 67098..67421 - 324 WP_000533253 hypothetical protein -
BE949_RS27725 (BE949_00545) 67717..67966 + 250 Protein_85 hypothetical protein -
BE949_RS00520 (BE949_00550) 68267..68389 - 123 WP_223195199 Hok/Gef family protein -
BE949_RS28035 68334..68486 - 153 Protein_87 DUF5431 family protein -
BE949_RS00525 (BE949_00555) 68637..68951 - 315 WP_001562885 hypothetical protein -

Host bacterium

ID   1371 GenBank   NZ_CP018973
Plasmid name   pEC545_3 Incompatibility group   IncFII
Plasmid size   70152 bp Coordinate of oriT [Strand]   63431..63709 [+]
Host baterium   Escherichia coli strain Ecol_545

Cargo genes

Drug resistance gene   blaCTX-M-27
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -