Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100902
Name   oriT_p2016C-3936C1_5 in_silico
Organism   Escherichia coli strain 2016C-3936C1
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP018775 (79139..79428 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_p2016C-3936C1_5
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAACGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACACTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   973 GenBank   WP_077253037
Name   TraI_p2016C-3936C1_5 insolico UniProt ID   _
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191812.34 Da        Isoelectric Point: 5.8411

>WP_077253037.1 conjugative transfer relaxase/helicase TraI [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGKLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVTSVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGETFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISRDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPNSSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRADITEREAALPESVLRESQREQEAVREVARENLLQERLQQIERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

DNA helicase TraI (TraI_C)

(1434-1557)

TrwC relaxase (TrwC)

(10-283)

AAA domain (AAA_30)

(968-1156)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 78577..108819

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BUE82_RS27635 (BUE82_28200) 74541..74975 + 435 WP_000845949 conjugation system SOS inhibitor PsiB -
BUE82_RS27640 (BUE82_28205) 74972..75734 + 763 Protein_70 plasmid SOS inhibition protein A -
BUE82_RS28720 75703..75891 - 189 WP_001299721 hypothetical protein -
BUE82_RS29365 75913..76062 + 150 Protein_72 plasmid maintenance protein Mok -
BUE82_RS27645 (BUE82_28215) 76004..76129 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
BUE82_RS29370 (BUE82_28220) 76349..76579 + 231 WP_001426396 hypothetical protein -
BUE82_RS29375 76577..76750 - 174 Protein_75 hypothetical protein -
BUE82_RS28900 (BUE82_28230) 76820..77026 + 207 WP_000547939 hypothetical protein -
BUE82_RS27665 (BUE82_28235) 77051..77338 + 288 WP_000107535 hypothetical protein -
BUE82_RS27670 (BUE82_28240) 77459..78280 + 822 WP_001234469 DUF932 domain-containing protein -
BUE82_RS27675 (BUE82_28245) 78577..79167 - 591 WP_000252680 transglycosylase SLT domain-containing protein virB1
BUE82_RS27680 (BUE82_28250) 79500..79883 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
BUE82_RS27685 (BUE82_28255) 80070..80759 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
BUE82_RS27690 (BUE82_28260) 80858..81253 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
BUE82_RS27695 (BUE82_28265) 81286..81651 + 366 WP_075631444 type IV conjugative transfer system pilin TraA -
BUE82_RS27700 (BUE82_28270) 81666..81977 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
BUE82_RS27705 (BUE82_28275) 81999..82565 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
BUE82_RS27710 (BUE82_28280) 82552..83280 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
BUE82_RS27715 (BUE82_28285) 83280..84707 + 1428 WP_000146692 F-type conjugal transfer pilus assembly protein TraB traB
BUE82_RS27720 (BUE82_28290) 84697..85287 + 591 WP_000002792 conjugal transfer pilus-stabilizing protein TraP -
BUE82_RS27725 (BUE82_28295) 85274..85471 + 198 WP_001324648 conjugal transfer protein TrbD -
BUE82_RS27730 (BUE82_28300) 85483..85734 + 252 WP_001038342 conjugal transfer protein TrbG -
BUE82_RS27735 (BUE82_28305) 85731..86246 + 516 WP_000809841 type IV conjugative transfer system lipoprotein TraV traV
BUE82_RS27740 (BUE82_28310) 86381..86602 + 222 WP_001278689 conjugal transfer protein TraR -
BUE82_RS27745 (BUE82_28315) 86762..87442 + 681 Protein_93 TraC family protein -
BUE82_RS27755 (BUE82_28325) 87478..88691 + 1214 WP_085949589 IS3-like element ISEc31 family transposase -
BUE82_RS27760 (BUE82_28330) 88698..90650 + 1953 Protein_95 type IV secretion system protein TraC -
BUE82_RS27765 (BUE82_28335) 90647..91033 + 387 WP_000097319 type-F conjugative transfer system protein TrbI -
BUE82_RS27770 (BUE82_28340) 91030..91662 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
BUE82_RS27775 (BUE82_28345) 91659..92651 + 993 WP_000830187 conjugal transfer pilus assembly protein TraU traU
BUE82_RS27780 (BUE82_28350) 92660..93298 + 639 WP_000777688 type-F conjugative transfer system pilin assembly protein TrbC trbC
BUE82_RS27785 (BUE82_28355) 93295..95103 + 1809 WP_000821847 type-F conjugative transfer system mating-pair stabilization protein TraN traN
BUE82_RS27790 (BUE82_28360) 95130..95387 + 258 WP_000864318 conjugal transfer protein TrbE -
BUE82_RS27795 (BUE82_28365) 95380..96123 + 744 WP_001030367 type-F conjugative transfer system pilin assembly protein TraF traF
BUE82_RS27800 (BUE82_28370) 96139..96486 + 348 WP_001287907 conjugal transfer protein TrbA -
BUE82_RS27805 (BUE82_28375) 96488..96763 - 276 WP_001513501 hypothetical protein -
BUE82_RS27810 (BUE82_28380) 97009..98550 + 1542 WP_001298859 IS21-like element ISEc12 family transposase -
BUE82_RS27815 (BUE82_28385) 98565..99311 + 747 WP_001016257 IS21-like element ISEc12 family helper ATPase IstB -
BUE82_RS27820 (BUE82_28390) 99514..99798 + 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
BUE82_RS27825 (BUE82_28395) 99785..100330 + 546 WP_000059833 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
BUE82_RS27830 (BUE82_28400) 100260..100601 + 342 WP_001442101 P-type conjugative transfer protein TrbJ -
BUE82_RS29380 100588..100980 + 393 Protein_110 F-type conjugal transfer protein TrbF -
BUE82_RS27845 (BUE82_28415) 100967..102340 + 1374 WP_000944319 conjugal transfer pilus assembly protein TraH traH
BUE82_RS27850 (BUE82_28420) 102337..105162 + 2826 WP_001007037 conjugal transfer mating-pair stabilization protein TraG traG
BUE82_RS27855 (BUE82_28425) 105159..105668 + 510 WP_000628107 conjugal transfer entry exclusion protein TraS -
BUE82_RS27860 (BUE82_28430) 105682..106413 + 732 WP_000850422 conjugal transfer complement resistance protein TraT -
BUE82_RS27865 (BUE82_28435) 106666..108819 + 2154 WP_000009325 type IV conjugative transfer system coupling protein TraD virb4
BUE82_RS27870 (BUE82_28440) 108828..109226 - 399 WP_000911333 tRNA(fMet)-specific endonuclease VapC -
BUE82_RS27875 (BUE82_28445) 109226..109453 - 228 WP_000450520 toxin-antitoxin system antitoxin VapB -

Host bacterium

ID   1361 GenBank   NZ_CP018775
Plasmid name   p2016C-3936C1_5 Incompatibility group   IncFIB
Plasmid size   174847 bp Coordinate of oriT [Strand]   79139..79428 [-]
Host baterium   Escherichia coli strain 2016C-3936C1

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -