Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100900
Name   oriT_pKp_Goe_641-2 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_121641
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018736 (42615..42720 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_641-2
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   971 GenBank   WP_074513113
Name   PutativerelaxaseofpKp_Goe_641-2 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75221.97 Da        Isoelectric Point: 9.9948

>WP_074513113.1 TraI/MobA(P) family conjugative relaxase [Klebsiella pneumoniae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEVVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 45516..63589

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB745_RS28750 (BB745_05400) 40600..40911 + 312 WP_004187333 hypothetical protein -
BB745_RS28755 (BB745_05401) 41044..41580 + 537 WP_004187332 hypothetical protein -
BB745_RS28760 (BB745_05402) 42082..42477 - 396 WP_019725163 hypothetical protein -
BB745_RS31490 (BB745_05403) 42512..43039 + 528 WP_172740549 plasmid mobilization protein MobA -
BB745_RS28770 (BB745_05404) 43026..45005 + 1980 WP_074513113 TraI/MobA(P) family conjugative relaxase -
BB745_RS28775 (BB745_05405) 45019..45519 + 501 WP_004187320 DotD/TraH family lipoprotein -
BB745_RS28780 (BB745_05406) 45516..46295 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB745_RS28785 (BB745_05407) 46306..47469 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB745_RS28790 (BB745_05408) 47459..47719 + 261 WP_004187310 IcmT/TraK family protein traK
BB745_RS31495 (BB745_05409) 47744..51181 + 3438 WP_015586048 LPD7 domain-containing protein -
BB745_RS28800 (BB745_05410) 51147..51659 + 513 WP_011091071 hypothetical protein traL
BB745_RS28805 51660..51872 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
BB745_RS28810 (BB745_05411) 51844..52254 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB745_RS28815 (BB745_05412) 52322..53035 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB745_RS28820 (BB745_05413) 53044..54195 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB745_RS28825 (BB745_05414) 54207..55556 + 1350 WP_004187474 conjugal transfer protein TraO traO
BB745_RS28830 (BB745_05415) 55568..56272 + 705 WP_015060002 conjugal transfer protein TraP traP
BB745_RS28835 (BB745_05416) 56296..56826 + 531 WP_004187478 conjugal transfer protein TraQ traQ
BB745_RS28840 (BB745_05417) 56843..57232 + 390 WP_004187479 DUF6750 family protein traR
BB745_RS28845 (BB745_05418) 57278..57772 + 495 WP_004187480 hypothetical protein -
BB745_RS28850 (BB745_05419) 57769..60819 + 3051 WP_004187482 hypothetical protein traU
BB745_RS28855 (BB745_05420) 60816..62024 + 1209 WP_011091082 conjugal transfer protein TraW traW
BB745_RS28860 (BB745_05421) 62021..62617 + 597 WP_032419542 hypothetical protein -
BB745_RS28865 62610..63589 + 980 WP_148722743 DotA/TraY family protein traY

Host bacterium

ID   1359 GenBank   NZ_CP018736
Plasmid name   pKp_Goe_641-2 Incompatibility group   IncL/M
Plasmid size   63589 bp Coordinate of oriT [Strand]   42615..42720 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_121641

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -