Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100899
Name   oriT_pKp_Goe_304-3 in_silico
Organism   Klebsiella pneumoniae strain KP_Goe_828304
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018723 (55044..55149 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_304-3
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   970 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_304-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 24951..52248

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB787_RS30270 (BB787_30270) 20579..21376 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
BB787_RS30285 (BB787_30285) 21595..22292 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB787_RS30290 (BB787_30290) 22289..23494 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB787_RS30295 (BB787_30295) 23509..23943 - 435 Protein_39 CPBP family intramembrane glutamate endopeptidase -
BB787_RS30300 (BB787_30300) 24023..24406 + 384 WP_019725042 DUF1496 domain-containing protein -
BB787_RS30305 (BB787_30305) 24511..24906 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB787_RS30310 (BB787_30310) 24951..26213 + 1263 WP_004206887 hypothetical protein trbA
BB787_RS30315 (BB787_30315) 26224..27174 + 951 WP_004206886 DsbC family protein trbB
BB787_RS30320 (BB787_30320) 27187..29274 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB787_RS33655 29325..29420 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB787_RS30325 (BB787_30325) 30643..31698 - 1056 WP_015060006 plasmid replication initiator RepA -
BB787_RS30330 (BB787_30330) 31994..32224 - 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB787_RS30335 (BB787_30335) 32305..32958 - 654 WP_015060005 hypothetical protein -
BB787_RS30340 (BB787_30340) 32960..35155 - 2196 WP_015062834 DotA/TraY family protein traY
BB787_RS30345 (BB787_30345) 35148..35744 - 597 WP_032419542 hypothetical protein -
BB787_RS30350 (BB787_30350) 35741..36949 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB787_RS30355 (BB787_30355) 36946..39996 - 3051 WP_004187482 hypothetical protein traU
BB787_RS30360 (BB787_30360) 39993..40487 - 495 WP_004187480 hypothetical protein -
BB787_RS30365 (BB787_30365) 40533..40922 - 390 WP_004187479 DUF6750 family protein traR
BB787_RS30370 (BB787_30370) 40939..41469 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB787_RS30375 (BB787_30375) 41493..42197 - 705 WP_015060002 conjugal transfer protein TraP traP
BB787_RS30380 (BB787_30380) 42209..43558 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB787_RS30385 (BB787_30385) 43570..44721 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB787_RS30390 (BB787_30390) 44730..45443 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB787_RS30395 (BB787_30395) 45511..45921 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB787_RS30400 (BB787_30400) 45950..46105 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB787_RS30405 (BB787_30405) 46106..46618 - 513 WP_011091071 hypothetical protein traL
BB787_RS30410 (BB787_30410) 46584..48260 - 1677 WP_025987682 LPD7 domain-containing protein -
BB787_RS30415 (BB787_30415) 48257..50020 - 1764 WP_074115708 toprim domain-containing protein -
BB787_RS30420 (BB787_30420) 50045..50305 - 261 WP_004187310 IcmT/TraK family protein traK
BB787_RS30425 (BB787_30425) 50295..51458 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB787_RS30430 (BB787_30430) 51469..52248 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB787_RS30435 (BB787_30435) 52245..52745 - 501 WP_004187320 DotD/TraH family lipoprotein -
BB787_RS30440 (BB787_30440) 52759..54738 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB787_RS33540 54725..55252 - 528 WP_172740549 plasmid mobilization protein MobA -
BB787_RS30450 (BB787_30450) 55287..55682 + 396 WP_019725163 hypothetical protein -
BB787_RS30455 (BB787_30455) 56184..56720 - 537 WP_004187332 hypothetical protein -
BB787_RS30460 (BB787_30460) 56853..57164 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   1358 GenBank   NZ_CP018723
Plasmid name   pKp_Goe_304-3 Incompatibility group   IncL/M
Plasmid size   63588 bp Coordinate of oriT [Strand]   55044..55149 [+]
Host baterium   Klebsiella pneumoniae strain KP_Goe_828304

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8