Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100898
Name   oriT_pKp_Goe_021-3 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_152021
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018717 (57939..58044 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_021-3
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   969 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_021-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 27800..55143

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB786_RS30280 (BB786_30280) 23473..24270 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
BB786_RS30295 (BB786_30295) 24489..25186 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB786_RS30300 (BB786_30300) 25183..26388 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB786_RS30305 (BB786_30305) 26403..26837 - 435 Protein_42 CPBP family intramembrane glutamate endopeptidase -
BB786_RS30310 (BB786_30310) 26917..27300 + 384 WP_019725042 DUF1496 domain-containing protein -
BB786_RS30315 (BB786_30315) 27405..27800 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB786_RS30320 (BB786_30320) 27800..29107 + 1308 WP_015059988 hypothetical protein trbA
BB786_RS30325 (BB786_30325) 29118..30068 + 951 WP_004206886 DsbC family protein trbB
BB786_RS30330 (BB786_30330) 30081..32168 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB786_RS33570 32219..32314 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB786_RS30335 (BB786_30335) 33537..34592 - 1056 WP_015060006 plasmid replication initiator RepA -
BB786_RS30340 (BB786_30340) 34888..35118 - 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB786_RS30345 (BB786_30345) 35199..35852 - 654 WP_015060005 hypothetical protein -
BB786_RS30350 (BB786_30350) 35854..38049 - 2196 WP_015062834 DotA/TraY family protein traY
BB786_RS30355 (BB786_30355) 38042..38638 - 597 WP_032419542 hypothetical protein -
BB786_RS30360 (BB786_30360) 38635..39843 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB786_RS30365 (BB786_30365) 39840..42890 - 3051 WP_004187482 hypothetical protein traU
BB786_RS30370 (BB786_30370) 42887..43381 - 495 WP_004187480 hypothetical protein -
BB786_RS30375 (BB786_30375) 43427..43816 - 390 WP_004187479 DUF6750 family protein traR
BB786_RS30380 (BB786_30380) 43833..44363 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB786_RS30385 (BB786_30385) 44387..45091 - 705 WP_015060002 conjugal transfer protein TraP traP
BB786_RS30390 (BB786_30390) 45103..46452 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB786_RS30395 (BB786_30395) 46464..47615 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB786_RS30400 (BB786_30400) 47624..48337 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB786_RS30405 (BB786_30405) 48405..48815 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB786_RS30410 (BB786_30410) 48844..48999 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB786_RS30415 (BB786_30415) 49000..49512 - 513 WP_011091071 hypothetical protein traL
BB786_RS33460 49478..52915 - 3438 WP_015586048 LPD7 domain-containing protein -
BB786_RS30425 (BB786_30425) 52940..53200 - 261 WP_004187310 IcmT/TraK family protein traK
BB786_RS30430 (BB786_30430) 53190..54353 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB786_RS30435 (BB786_30435) 54364..55143 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB786_RS30440 (BB786_30440) 55140..55640 - 501 WP_004187320 DotD/TraH family lipoprotein -
BB786_RS30445 (BB786_30445) 55654..57633 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB786_RS33465 57620..58147 - 528 WP_172740549 plasmid mobilization protein MobA -
BB786_RS30455 (BB786_30455) 58182..58577 + 396 WP_019725163 hypothetical protein -
BB786_RS30460 (BB786_30460) 59079..59615 - 537 WP_004187332 hypothetical protein -
BB786_RS30465 (BB786_30465) 59748..60059 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   1357 GenBank   NZ_CP018717
Plasmid name   pKp_Goe_021-3 Incompatibility group   IncL/M
Plasmid size   63589 bp Coordinate of oriT [Strand]   57939..58044 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_152021

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -