Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100897
Name   oriT_pKp_Goe_026-3 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_827026
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018712 (61157..61262 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_026-3
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   968 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_026-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 31018..58361

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB785_RS30730 (BB785_30730) 26691..27488 - 798 Protein_46 OXA-48 family class D beta-lactamase -
BB785_RS30745 (BB785_30745) 27707..28404 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB785_RS30750 (BB785_30750) 28401..29606 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB785_RS30755 (BB785_30755) 29621..30055 - 435 Protein_49 CPBP family intramembrane glutamate endopeptidase -
BB785_RS30760 (BB785_30760) 30135..30518 + 384 WP_019725042 DUF1496 domain-containing protein -
BB785_RS30765 (BB785_30765) 30623..31018 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB785_RS30770 (BB785_30770) 31018..32325 + 1308 WP_015059988 hypothetical protein trbA
BB785_RS30775 (BB785_30775) 32336..33286 + 951 WP_004206886 DsbC family protein trbB
BB785_RS30780 (BB785_30780) 33299..35386 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB785_RS33695 35437..35532 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB785_RS30785 (BB785_30785) 36755..37810 - 1056 WP_015060006 plasmid replication initiator RepA -
BB785_RS30790 (BB785_30790) 38106..38336 - 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB785_RS30795 (BB785_30795) 38417..39070 - 654 WP_015060005 hypothetical protein -
BB785_RS30800 (BB785_30800) 39072..41267 - 2196 WP_015062834 DotA/TraY family protein traY
BB785_RS30805 (BB785_30805) 41260..41856 - 597 WP_032419542 hypothetical protein -
BB785_RS30810 (BB785_30810) 41853..43061 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB785_RS30815 (BB785_30815) 43058..46108 - 3051 WP_004187482 hypothetical protein traU
BB785_RS30820 (BB785_30820) 46105..46599 - 495 WP_004187480 hypothetical protein -
BB785_RS30825 (BB785_30825) 46645..47034 - 390 WP_004187479 DUF6750 family protein traR
BB785_RS30830 (BB785_30830) 47051..47581 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB785_RS30835 (BB785_30835) 47605..48309 - 705 WP_015060002 conjugal transfer protein TraP traP
BB785_RS30840 (BB785_30840) 48321..49670 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB785_RS30845 (BB785_30845) 49682..50833 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB785_RS30850 (BB785_30850) 50842..51555 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB785_RS30855 (BB785_30855) 51623..52033 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB785_RS30860 (BB785_30860) 52062..52217 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB785_RS30865 (BB785_30865) 52218..52730 - 513 WP_011091071 hypothetical protein traL
BB785_RS33585 52696..56133 - 3438 WP_015586048 LPD7 domain-containing protein -
BB785_RS30875 (BB785_30875) 56158..56418 - 261 WP_004187310 IcmT/TraK family protein traK
BB785_RS30880 (BB785_30880) 56408..57571 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB785_RS30885 (BB785_30885) 57582..58361 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB785_RS30890 (BB785_30890) 58358..58858 - 501 WP_004187320 DotD/TraH family lipoprotein -
BB785_RS30895 (BB785_30895) 58872..60851 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB785_RS33590 60838..61365 - 528 WP_172740549 plasmid mobilization protein MobA -
BB785_RS30905 (BB785_30905) 61400..61795 + 396 WP_019725163 hypothetical protein -
BB785_RS30910 (BB785_30910) 62297..62833 - 537 WP_004187332 hypothetical protein -
BB785_RS30915 (BB785_30915) 62966..63277 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   1356 GenBank   NZ_CP018712
Plasmid name   pKp_Goe_026-3 Incompatibility group   IncL/M
Plasmid size   63583 bp Coordinate of oriT [Strand]   61157..61262 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_827026

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -