Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100896
Name   oriT_pKp_Goe_024-3 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_827024
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018706 (8036..8141 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_024-3
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   967 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_024-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 41485..63197

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB784_RS30790 (BB784_30790) 37158..37955 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
BB784_RS30805 (BB784_30805) 38174..38871 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB784_RS30810 (BB784_30810) 38868..40073 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB784_RS30815 (BB784_30815) 40088..40522 - 435 Protein_59 CPBP family intramembrane glutamate endopeptidase -
BB784_RS30820 (BB784_30820) 40602..40985 + 384 WP_019725042 DUF1496 domain-containing protein -
BB784_RS30825 (BB784_30825) 41090..41485 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB784_RS30830 (BB784_30830) 41485..42792 + 1308 WP_015059988 hypothetical protein trbA
BB784_RS30835 (BB784_30835) 42803..43753 + 951 WP_004206886 DsbC family protein trbB
BB784_RS30840 (BB784_30840) 43766..45853 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB784_RS33590 45904..45999 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB784_RS30845 (BB784_30845) 47222..48277 - 1056 WP_015060006 plasmid replication initiator RepA -
BB784_RS30850 (BB784_30850) 48573..48803 - 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB784_RS30855 (BB784_30855) 48884..49537 - 654 WP_015060005 hypothetical protein -
BB784_RS30860 (BB784_30860) 49539..51734 - 2196 WP_015062834 DotA/TraY family protein traY
BB784_RS30865 (BB784_30865) 51727..52323 - 597 WP_032419542 hypothetical protein -
BB784_RS30870 (BB784_30870) 52320..53528 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB784_RS30875 (BB784_30875) 53525..56575 - 3051 WP_004187482 hypothetical protein traU
BB784_RS30880 (BB784_30880) 56572..57066 - 495 WP_004187480 hypothetical protein -
BB784_RS30885 (BB784_30885) 57112..57501 - 390 WP_004187479 DUF6750 family protein traR
BB784_RS30890 (BB784_30890) 57518..58048 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB784_RS30895 (BB784_30895) 58072..58776 - 705 WP_015060002 conjugal transfer protein TraP traP
BB784_RS30900 (BB784_30900) 58788..60137 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB784_RS30905 (BB784_30905) 60149..61300 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB784_RS30910 (BB784_30910) 61309..62022 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB784_RS30915 (BB784_30915) 62090..62500 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB784_RS30920 (BB784_30920) 62529..62684 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB784_RS30925 (BB784_30925) 62685..63197 - 513 WP_011091071 hypothetical protein traL

Host bacterium

ID   1355 GenBank   NZ_CP018706
Plasmid name   pKp_Goe_024-3 Incompatibility group   IncL/M
Plasmid size   63588 bp Coordinate of oriT [Strand]   8036..8141 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_827024

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -