Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100894
Name   oriT_pKp_Goe_832-3 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_149832
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018700 (55367..55472 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_832-3
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   965 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_832-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 310..22022

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB751_RS33485 33..344 + 312 WP_228707232 hypothetical protein -
BB751_RS33235 (BB751_30525) 310..822 + 513 WP_011091071 hypothetical protein traL
BB751_RS30530 (BB751_30530) 823..1035 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
BB751_RS30535 (BB751_30535) 1007..1417 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB751_RS30540 (BB751_30540) 1485..2198 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB751_RS30545 (BB751_30545) 2207..3358 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB751_RS30550 (BB751_30550) 3370..4719 + 1350 WP_004187474 conjugal transfer protein TraO traO
BB751_RS30555 (BB751_30555) 4731..5435 + 705 WP_015060002 conjugal transfer protein TraP traP
BB751_RS30560 (BB751_30560) 5459..5989 + 531 WP_004187478 conjugal transfer protein TraQ traQ
BB751_RS30565 (BB751_30565) 6006..6395 + 390 WP_004187479 DUF6750 family protein traR
BB751_RS30570 (BB751_30570) 6441..6935 + 495 WP_004187480 hypothetical protein -
BB751_RS30575 (BB751_30575) 6932..9982 + 3051 WP_004187482 hypothetical protein traU
BB751_RS30580 (BB751_30580) 9979..11187 + 1209 WP_011091082 conjugal transfer protein TraW traW
BB751_RS30585 (BB751_30585) 11184..11780 + 597 WP_032419542 hypothetical protein -
BB751_RS30590 (BB751_30590) 11773..13968 + 2196 WP_015062834 DotA/TraY family protein traY
BB751_RS30595 (BB751_30595) 13970..14623 + 654 WP_015060005 hypothetical protein -
BB751_RS30600 (BB751_30600) 14692..14934 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
BB751_RS30605 (BB751_30605) 15230..16285 + 1056 WP_015060006 plasmid replication initiator RepA -
BB751_RS33610 17508..17603 + 96 WP_004206884 DinQ-like type I toxin DqlB -
BB751_RS30610 (BB751_30610) 17654..19741 - 2088 WP_004206885 conjugal transfer protein TrbC -
BB751_RS30615 (BB751_30615) 19754..20704 - 951 WP_004206886 DsbC family protein trbB
BB751_RS30620 (BB751_30620) 20715..22022 - 1308 WP_015059988 hypothetical protein trbA
BB751_RS30625 (BB751_30625) 22022..22417 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB751_RS30630 (BB751_30630) 22522..22905 - 384 WP_019725042 DUF1496 domain-containing protein -
BB751_RS30635 (BB751_30635) 22985..23419 + 435 Protein_25 CPBP family intramembrane glutamate endopeptidase -
BB751_RS30640 (BB751_30640) 23434..24639 - 1206 WP_025987686 IS4-like element IS10A family transposase -
BB751_RS30660 (BB751_30660) 25552..26349 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -


Host bacterium


ID   1353 GenBank   NZ_CP018700
Plasmid name   pKp_Goe_832-3 Incompatibility group   IncL/M
Plasmid size   63588 bp Coordinate of oriT [Strand]   55367..55472 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_149832

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -