Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100892
Name   oriT_pKp_Goe_473-3 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_149473
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018690 (56531..56636 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_473-3
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   963 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_473-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 26392..53735

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB750_RS30270 (BB750_30270) 22065..22862 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
BB750_RS30285 (BB750_30285) 23081..23778 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB750_RS30290 (BB750_30290) 23775..24980 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB750_RS30295 (BB750_30295) 24995..25429 - 435 Protein_40 CPBP family intramembrane glutamate endopeptidase -
BB750_RS30300 (BB750_30300) 25509..25892 + 384 WP_019725042 DUF1496 domain-containing protein -
BB750_RS30305 (BB750_30305) 25997..26392 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB750_RS30310 (BB750_30310) 26392..27699 + 1308 WP_015059988 hypothetical protein trbA
BB750_RS30315 (BB750_30315) 27710..28660 + 951 WP_004206886 DsbC family protein trbB
BB750_RS30320 (BB750_30320) 28673..30760 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB750_RS33545 30811..30906 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB750_RS30325 (BB750_30325) 32129..33184 - 1056 WP_015060006 plasmid replication initiator RepA -
BB750_RS30330 (BB750_30330) 33480..33710 - 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB750_RS30335 (BB750_30335) 33791..34444 - 654 WP_015060005 hypothetical protein -
BB750_RS30340 (BB750_30340) 34446..36641 - 2196 WP_015062834 DotA/TraY family protein traY
BB750_RS30345 (BB750_30345) 36634..37230 - 597 WP_032419542 hypothetical protein -
BB750_RS30350 (BB750_30350) 37227..38435 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB750_RS30355 (BB750_30355) 38432..41482 - 3051 WP_004187482 hypothetical protein traU
BB750_RS30360 (BB750_30360) 41479..41973 - 495 WP_004187480 hypothetical protein -
BB750_RS30365 (BB750_30365) 42019..42408 - 390 WP_004187479 DUF6750 family protein traR
BB750_RS30370 (BB750_30370) 42425..42955 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB750_RS30375 (BB750_30375) 42979..43683 - 705 WP_015060002 conjugal transfer protein TraP traP
BB750_RS30380 (BB750_30380) 43695..45044 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB750_RS30385 (BB750_30385) 45056..46207 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB750_RS30390 (BB750_30390) 46216..46929 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB750_RS30395 (BB750_30395) 46997..47407 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB750_RS30400 (BB750_30400) 47436..47591 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB750_RS30405 (BB750_30405) 47592..48104 - 513 WP_011091071 hypothetical protein traL
BB750_RS33435 48070..51507 - 3438 WP_015586048 LPD7 domain-containing protein -
BB750_RS30415 (BB750_30415) 51532..51792 - 261 WP_004187310 IcmT/TraK family protein traK
BB750_RS30420 (BB750_30420) 51782..52945 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB750_RS30425 (BB750_30425) 52956..53735 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB750_RS30430 (BB750_30430) 53732..54232 - 501 WP_004187320 DotD/TraH family lipoprotein -
BB750_RS30435 (BB750_30435) 54246..56225 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB750_RS33440 56212..56739 - 528 WP_172740549 plasmid mobilization protein MobA -
BB750_RS30445 (BB750_30445) 56774..57169 + 396 WP_019725163 hypothetical protein -
BB750_RS30450 (BB750_30450) 57671..58207 - 537 WP_004187332 hypothetical protein -
BB750_RS30455 (BB750_30455) 58340..58651 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   1351 GenBank   NZ_CP018690
Plasmid name   pKp_Goe_473-3 Incompatibility group   IncL/M
Plasmid size   63589 bp Coordinate of oriT [Strand]   56531..56636 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_149473

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -