Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100890
Name   oriT_pKPC_CAV1042-89 in_silico
Organism   Klebsiella pneumoniae strain CAV1042
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018669 (8300..8404 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pKPC_CAV1042-89
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   961 GenBank   WP_004206924
Name   PutativerelaxaseofpKPC_CAV1042-89 insolico UniProt ID   A0A0U3I0I2
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A0U3I0I2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 74994..87516

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AGE78_RS00820 (AGE78_00820) 70977..71510 + 534 Protein_90 IS110-like element IS4321 family transposase -
AGE78_RS00825 (AGE78_00825) 72682..73737 - 1056 WP_015062846 plasmid replication initiator RepA -
AGE78_RS00830 (AGE78_00830) 74034..74264 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
AGE78_RS00835 (AGE78_00835) 74338..74991 - 654 WP_004206935 hypothetical protein -
AGE78_RS00840 (AGE78_00840) 74994..77174 - 2181 WP_004187492 DotA/TraY family protein traY
AGE78_RS00845 (AGE78_00845) 77167..77817 - 651 WP_004187488 hypothetical protein -
AGE78_RS00850 (AGE78_00850) 77814..79022 - 1209 WP_004187486 conjugal transfer protein TraW traW
AGE78_RS00855 (AGE78_00855) 79019..82069 - 3051 WP_011154474 conjugative transfer protein traU
AGE78_RS00860 (AGE78_00860) 82066..82560 - 495 WP_004187480 hypothetical protein -
AGE78_RS00865 (AGE78_00865) 82606..82995 - 390 WP_011154472 DUF6750 family protein traR
AGE78_RS00870 (AGE78_00870) 83012..83542 - 531 WP_004187478 conjugal transfer protein TraQ traQ
AGE78_RS00875 (AGE78_00875) 83566..84270 - 705 WP_004206933 conjugal transfer protein TraP traP
AGE78_RS00880 (AGE78_00880) 84282..85631 - 1350 WP_004206932 conjugal transfer protein TraO traO
AGE78_RS00885 (AGE78_00885) 85643..86794 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AGE78_RS00890 (AGE78_00890) 86803..87516 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AGE78_RS00895 (AGE78_00895) 87584..87994 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AGE78_RS00900 (AGE78_00900) 88023..88178 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -

Host bacterium

ID   1349 GenBank   NZ_CP018669
Plasmid name   pKPC_CAV1042-89 Incompatibility group   IncL/M
Plasmid size   88688 bp Coordinate of oriT [Strand]   8300..8404 [-]
Host baterium   Klebsiella pneumoniae strain CAV1042

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -