Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100888
Name   oriT_pKp_Goe_795-2 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_39795
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018461 (14163..14268 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_795-2
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   959 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_795-2 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 17064..44362

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB789_RS29155 (BB789_29000) 12148..12459 + 312 WP_004187333 hypothetical protein -
BB789_RS29160 (BB789_29005) 12592..13128 + 537 WP_004187332 hypothetical protein -
BB789_RS29165 (BB789_29010) 13630..13995 - 366 WP_004187330 hypothetical protein -
BB789_RS29170 (BB789_29015) 14270..14587 + 318 WP_011091068 plasmid mobilization protein MobA -
BB789_RS29175 (BB789_29020) 14574..16553 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB789_RS29180 (BB789_29025) 16567..17067 + 501 WP_004187320 DotD/TraH family lipoprotein -
BB789_RS29185 (BB789_29030) 17064..17843 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB789_RS29190 (BB789_29035) 17854..19017 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB789_RS29195 (BB789_29040) 19007..19267 + 261 WP_004187310 IcmT/TraK family protein traK
BB789_RS29200 (BB789_29045) 21053..22729 + 1677 WP_025987682 LPD7 domain-containing protein -
BB789_RS29205 (BB789_29050) 22695..23207 + 513 WP_011091071 hypothetical protein traL
BB789_RS29210 (BB789_29055) 23208..23405 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
BB789_RS29215 (BB789_29060) 23392..23802 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB789_RS29220 (BB789_29065) 23801..24583 + 783 WP_015058941 DotI/IcmL family type IV secretion protein traM
BB789_RS29225 (BB789_29070) 24592..25743 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB789_RS29230 (BB789_29075) 25755..27104 + 1350 WP_004187474 conjugal transfer protein TraO traO
BB789_RS29235 (BB789_29080) 27116..27820 + 705 WP_015060002 conjugal transfer protein TraP traP
BB789_RS29240 (BB789_29085) 27844..28374 + 531 WP_004187478 conjugal transfer protein TraQ traQ
BB789_RS29245 (BB789_29090) 28391..28780 + 390 WP_004187479 DUF6750 family protein traR
BB789_RS29250 (BB789_29095) 28826..29320 + 495 WP_004187480 hypothetical protein -
BB789_RS29255 (BB789_29100) 29317..32367 + 3051 WP_004187482 hypothetical protein traU
BB789_RS29260 (BB789_29105) 32364..33572 + 1209 WP_011091082 conjugal transfer protein TraW traW
BB789_RS29265 (BB789_29110) 33569..34165 + 597 WP_015060003 hypothetical protein -
BB789_RS29270 (BB789_29115) 34158..36353 + 2196 WP_015062834 DotA/TraY family protein traY
BB789_RS29275 (BB789_29120) 36355..37008 + 654 WP_015060005 hypothetical protein -
BB789_RS29280 (BB789_29125) 37089..37319 + 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB789_RS29285 (BB789_29130) 37603..38670 + 1068 WP_019725043 plasmid replication initiator RepA -
BB789_RS29290 (BB789_29135) 40039..42126 - 2088 WP_004206885 conjugal transfer protein TrbC -
BB789_RS29295 (BB789_29140) 42139..43089 - 951 WP_004206886 DsbC family protein trbB
BB789_RS29300 (BB789_29145) 43100..44362 - 1263 WP_004206887 hypothetical protein trbA
BB789_RS29305 (BB789_29150) 44407..44802 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB789_RS29310 (BB789_29155) 44907..45290 - 384 WP_019725042 DUF1496 domain-containing protein -
BB789_RS29315 (BB789_29160) 45370..45840 + 471 WP_019725041 hypothetical protein -
BB789_RS29320 (BB789_29165) 45819..47069 - 1251 WP_011790968 IS4-like element IS10A family transposase -
BB789_RS29325 (BB789_29170) 47330..48241 + 912 WP_015586033 LysR family transcriptional regulator -
BB789_RS29330 (BB789_29175) 48543..49340 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -

Host bacterium

ID   1347 GenBank   NZ_CP018461
Plasmid name   pKp_Goe_795-2 Incompatibility group   IncL/M
Plasmid size   63593 bp Coordinate of oriT [Strand]   14163..14268 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_39795

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -