Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100886
Name   oriT_pKp_Goe_070-2 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_71070
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018452 (48350..48454 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pKp_Goe_070-2
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   957 GenBank   WP_004206924
Name   PutativerelaxaseofpKp_Goe_070-2 insolico UniProt ID   A0A0U3I0I2
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A0U3I0I2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 26356..45552

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB748_RS29515 (BB748_29355) 22030..22671 + 642 WP_227521796 hypothetical protein -
BB748_RS31860 22722..22817 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB748_RS29520 (BB748_29360) 24044..25099 - 1056 WP_021526650 plasmid replication initiator RepA -
BB748_RS29525 (BB748_29365) 25396..25626 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
BB748_RS29530 (BB748_29370) 25700..26353 - 654 WP_004206935 hypothetical protein -
BB748_RS29535 (BB748_29375) 26356..28536 - 2181 WP_004187492 DotA/TraY family protein traY
BB748_RS29540 (BB748_29380) 28529..29179 - 651 WP_004187488 hypothetical protein -
BB748_RS29545 (BB748_29385) 29176..30384 - 1209 WP_004187486 conjugal transfer protein TraW traW
BB748_RS29550 (BB748_29390) 30381..33431 - 3051 WP_011154474 conjugative transfer protein traU
BB748_RS29555 (BB748_29395) 33428..33922 - 495 WP_004187480 hypothetical protein -
BB748_RS29560 (BB748_29400) 33968..34357 - 390 WP_011154472 DUF6750 family protein traR
BB748_RS29565 (BB748_29405) 34374..34904 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB748_RS29570 (BB748_29410) 34928..35632 - 705 WP_004206933 conjugal transfer protein TraP traP
BB748_RS29575 (BB748_29415) 35644..36993 - 1350 WP_036970781 conjugal transfer protein TraO traO
BB748_RS29580 (BB748_29420) 37005..38156 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
BB748_RS29585 (BB748_29425) 38165..38878 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
BB748_RS29590 (BB748_29430) 38946..39356 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB748_RS29595 (BB748_29435) 39385..39540 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB748_RS29600 (BB748_29440) 39541..40053 - 513 WP_011091071 hypothetical protein traL
BB748_RS31775 40019..43324 - 3306 WP_220381329 LPD7 domain-containing protein -
BB748_RS29610 (BB748_29450) 43349..43609 - 261 WP_004187310 IcmT/TraK family protein traK
BB748_RS29615 (BB748_29455) 43599..44762 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
BB748_RS29620 (BB748_29460) 44773..45552 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB748_RS29625 (BB748_29465) 45549..46049 - 501 WP_004206925 DotD/TraH family lipoprotein -
BB748_RS29630 (BB748_29470) 46063..48042 - 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
BB748_RS29635 (BB748_29475) 48029..48346 - 318 WP_004206923 plasmid mobilization protein MobA -
BB748_RS29640 (BB748_29480) 48622..48987 + 366 WP_015586046 hypothetical protein -
BB748_RS29645 (BB748_29485) 49488..50024 - 537 WP_036970776 hypothetical protein -
BB748_RS29650 (BB748_29490) 50157..50468 - 312 WP_004187333 hypothetical protein -

Host bacterium

ID   1345 GenBank   NZ_CP018452
Plasmid name   pKp_Goe_070-2 Incompatibility group   IncL/M
Plasmid size   67100 bp Coordinate of oriT [Strand]   48350..48454 [-]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_71070

Cargo genes

Drug resistance gene   blaOXA-48, aph(3'')-Ib, aph(3')-VIb, blaCTX-M-14b
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -