Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100882
Name   oriT_pKp_Goe_414-5 in_silico
Organism   Klebsiella pneumoniae isolate Kp_Goe_154414
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018342 (8042..8147 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_414-5
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   953 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_414-5 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 41492..63204

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB788_RS30500 (BB788_30210) 37165..37962 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
BB788_RS30515 (BB788_30220) 38181..38878 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB788_RS30520 (BB788_30225) 38875..40080 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB788_RS30525 (BB788_30230) 40095..40529 - 435 Protein_60 CPBP family intramembrane glutamate endopeptidase -
BB788_RS30530 (BB788_30235) 40609..40992 + 384 WP_019725042 DUF1496 domain-containing protein -
BB788_RS30535 (BB788_30240) 41097..41492 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB788_RS30540 (BB788_30245) 41492..42799 + 1308 WP_015059988 hypothetical protein trbA
BB788_RS30545 (BB788_30250) 42810..43760 + 951 WP_004206886 DsbC family protein trbB
BB788_RS30550 (BB788_30255) 43773..45860 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB788_RS33220 45911..46006 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB788_RS30555 (BB788_30260) 47229..48284 - 1056 WP_015060006 plasmid replication initiator RepA -
BB788_RS30560 (BB788_30265) 48580..48822 - 243 WP_023893611 IncL/M type plasmid replication protein RepC -
BB788_RS30565 (BB788_30270) 48891..49544 - 654 WP_015060005 hypothetical protein -
BB788_RS30570 (BB788_30275) 49546..51741 - 2196 WP_015062834 DotA/TraY family protein traY
BB788_RS30575 (BB788_30280) 51734..52330 - 597 WP_015060003 hypothetical protein -
BB788_RS30580 (BB788_30285) 52327..53535 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB788_RS30585 (BB788_30290) 53532..56582 - 3051 WP_004187482 hypothetical protein traU
BB788_RS30590 (BB788_30295) 56579..57073 - 495 WP_004187480 hypothetical protein -
BB788_RS30595 (BB788_30300) 57119..57508 - 390 WP_004187479 DUF6750 family protein traR
BB788_RS30600 (BB788_30305) 57525..58055 - 531 WP_004187478 conjugal transfer protein TraQ traQ
BB788_RS30605 (BB788_30310) 58079..58783 - 705 WP_015060002 conjugal transfer protein TraP traP
BB788_RS30610 (BB788_30315) 58795..60144 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB788_RS30615 (BB788_30320) 60156..61307 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB788_RS30620 (BB788_30325) 61316..62029 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB788_RS30625 (BB788_30330) 62097..62507 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB788_RS30630 (BB788_30335) 62536..62691 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB788_RS30635 (BB788_30340) 62692..63204 - 513 WP_011091071 hypothetical protein traL


Host bacterium


ID   1341 GenBank   NZ_CP018342
Plasmid name   pKp_Goe_414-5 Incompatibility group   IncL/M
Plasmid size   63588 bp Coordinate of oriT [Strand]   8042..8147 [+]
Host baterium   Klebsiella pneumoniae isolate Kp_Goe_154414

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8