Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100879
Name   oriT_pKp_Goe_579-3 in_silico
Organism   Klebsiella pneumoniae strain Kp_Goe_822579
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP018315 (14097..14202 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKp_Goe_579-3
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   950 GenBank   WP_004187323
Name   PutativerelaxaseofpKp_Goe_579-3 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 545..11301

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB744_RS29355 (BB744_05511) 545..1249 - 705 WP_015060002 conjugal transfer protein TraP traP
BB744_RS29360 (BB744_05512) 1261..2610 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB744_RS29365 (BB744_05513) 2622..3773 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB744_RS29370 (BB744_05514) 3782..4495 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB744_RS29375 (BB744_05515) 4563..4973 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB744_RS29380 5002..5157 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB744_RS29385 (BB744_05516) 5158..5670 - 513 WP_011091071 hypothetical protein traL
BB744_RS33490 (BB744_05517) 5636..9073 - 3438 WP_015586048 LPD7 domain-containing protein -
BB744_RS29395 (BB744_05518) 9098..9358 - 261 WP_004187310 IcmT/TraK family protein traK
BB744_RS29400 (BB744_05519) 9348..10511 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB744_RS29405 (BB744_05520) 10522..11301 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB744_RS29410 (BB744_05521) 11298..11798 - 501 WP_004187320 DotD/TraH family lipoprotein -
BB744_RS29415 (BB744_05522) 11812..13791 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB744_RS33495 (BB744_05523) 13778..14305 - 528 WP_172740549 plasmid mobilization protein MobA -
BB744_RS29425 (BB744_05524) 14340..14735 + 396 WP_019725163 hypothetical protein -
BB744_RS29430 (BB744_05526) 15237..15773 - 537 WP_004187332 hypothetical protein -
BB744_RS29435 (BB744_05527) 15906..16217 - 312 WP_004187333 hypothetical protein -

Region 2: 123..11301

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB744_RS29355 (BB744_05511) 545..1249 - 705 WP_015060002 conjugal transfer protein TraP traP
BB744_RS29360 (BB744_05512) 1261..2610 - 1350 WP_004187474 conjugal transfer protein TraO traO
BB744_RS29365 (BB744_05513) 2622..3773 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
BB744_RS29370 (BB744_05514) 3782..4495 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
BB744_RS29375 (BB744_05515) 4563..4973 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
BB744_RS29380 5002..5157 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
BB744_RS29385 (BB744_05516) 5158..5670 - 513 WP_011091071 hypothetical protein traL
BB744_RS33490 (BB744_05517) 5636..9073 - 3438 WP_015586048 LPD7 domain-containing protein -
BB744_RS29395 (BB744_05518) 9098..9358 - 261 WP_004187310 IcmT/TraK family protein traK
BB744_RS29400 (BB744_05519) 9348..10511 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
BB744_RS29405 (BB744_05520) 10522..11301 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
BB744_RS29410 (BB744_05521) 11298..11798 - 501 WP_004187320 DotD/TraH family lipoprotein -
BB744_RS29415 (BB744_05522) 11812..13791 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
BB744_RS33495 (BB744_05523) 13778..14305 - 528 WP_172740549 plasmid mobilization protein MobA -
BB744_RS29425 (BB744_05524) 14340..14735 + 396 WP_019725163 hypothetical protein -
BB744_RS29430 (BB744_05526) 15237..15773 - 537 WP_004187332 hypothetical protein -
BB744_RS29435 (BB744_05527) 15906..16217 - 312 WP_004187333 hypothetical protein -

Region 3: 47592..63563

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BB744_RS29675 (BB744_05576) 43220..44017 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
BB744_RS29690 (BB744_05579) 44236..44933 + 698 WP_095033700 IS1-like element IS1B family transposase -
BB744_RS29695 (BB744_05580) 44930..46135 + 1206 WP_025987686 IS4-like element IS10A family transposase -
BB744_RS29700 (BB744_05581) 46150..46584 - 435 Protein_67 CPBP family intramembrane glutamate endopeptidase -
BB744_RS29705 (BB744_05582) 46664..47047 + 384 WP_019725042 DUF1496 domain-containing protein -
BB744_RS29710 (BB744_05583) 47152..47547 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
BB744_RS29715 (BB744_05584) 47592..48854 + 1263 WP_004206887 hypothetical protein trbA
BB744_RS29720 (BB744_05585) 48865..49815 + 951 WP_004206886 DsbC family protein trbB
BB744_RS29725 (BB744_05586) 49828..51915 + 2088 WP_004206885 conjugal transfer protein TrbC -
BB744_RS33645 51966..52061 - 96 WP_004206884 DinQ-like type I toxin DqlB -
BB744_RS29730 (BB744_05587) 53284..54339 - 1056 WP_015060006 plasmid replication initiator RepA -
BB744_RS29735 (BB744_05589) 54635..54865 - 231 WP_011091085 IncL/M type plasmid replication protein RepC -
BB744_RS29740 (BB744_05590) 54946..55599 - 654 WP_015060005 hypothetical protein -
BB744_RS29745 (BB744_05591) 55601..57796 - 2196 WP_015062834 DotA/TraY family protein traY
BB744_RS29750 (BB744_05592) 57789..58385 - 597 WP_032419542 hypothetical protein -
BB744_RS29755 (BB744_05593) 58382..59590 - 1209 WP_011091082 conjugal transfer protein TraW traW
BB744_RS29760 (BB744_05594) 59587..62637 - 3051 WP_004187482 hypothetical protein traU
BB744_RS29765 (BB744_05595) 62634..63128 - 495 WP_004187480 hypothetical protein -
BB744_RS29770 (BB744_05596) 63174..63563 - 390 WP_004187479 DUF6750 family protein traR


Host bacterium


ID   1338 GenBank   NZ_CP018315
Plasmid name   pKp_Goe_579-3 Incompatibility group   IncL/M
Plasmid size   63587 bp Coordinate of oriT [Strand]   14097..14202 [+]
Host baterium   Klebsiella pneumoniae strain Kp_Goe_822579

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -