Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100870 |
Name | oriT_pMR0716_ColRNAI |
Organism | Escherichia coli strain MRSN352231 |
Sequence Completeness | intact |
NCBI accession of oriT (coordinates [strand]) | NZ_CP018108 (1647..1730 [+], 84 nt) |
oriT length | 84 nt |
IRs (inverted repeats) | 3..12, 16..25 (GTGTCGGGGC..GCCCTGACCC) |
Location of nic site | 56..57 |
Conserved sequence flanking the nic site |
CTGG|CTTA |
Note | predicted by the oriTfinder |
oriT sequence
Download Length: 84 nt
>oriT_pMR0716_ColRNAI
GGGGTGTCGGGGCGAAGCCCTGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTAACCATTCGGCATCAGTGCGGATT
GGGGTGTCGGGGCGAAGCCCTGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTAACCATTCGGCATCAGTGCGGATT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 941 | GenBank | WP_000955999 |
Name | MobC_pMR0716_ColRNAI | UniProt ID | _ |
Length | 107 a.a. | PDB ID | |
Note | putative relaxase |
Relaxase protein sequence
Download Length: 107 a.a. Molecular weight: 11855.71 Da Isoelectric Point: 10.8973
>WP_000955999.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
ID | 1329 | GenBank | NZ_CP018108 |
Plasmid name | pMR0716_ColRNAI | Incompatibility group | ColRNAI |
Plasmid size | 5310 bp | Coordinate of oriT [Strand] | 1647..1730 [+] |
Host baterium | Escherichia coli strain MRSN352231 |
Cargo genes
Drug resistance gene | aph(3')-Ia |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |