Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100865
Name   oriT_pCAV1016-76 in_silico
Organism   Klebsiella pneumoniae strain CAV1016
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP017936 (11218..11322 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pCAV1016-76
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   937 GenBank   WP_004206924
Name   PutativerelaxaseofpCAV1016-76 insolico UniProt ID   A0A0U3I0I2
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A0U3I0I2


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 14120..33316

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AGE75_RS27370 (AGE75_27370) 9204..9515 + 312 WP_004187333 hypothetical protein -
AGE75_RS27375 (AGE75_27375) 9648..10184 + 537 WP_004206920 hypothetical protein -
AGE75_RS27380 (AGE75_27380) 10685..11050 - 366 WP_004206922 hypothetical protein -
AGE75_RS27385 (AGE75_27385) 11326..11643 + 318 WP_004206923 plasmid mobilization protein MobA -
AGE75_RS27390 (AGE75_27390) 11630..13609 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
AGE75_RS27395 (AGE75_27395) 13623..14123 + 501 WP_004206925 DotD/TraH family lipoprotein -
AGE75_RS27400 (AGE75_27400) 14120..14899 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
AGE75_RS27405 (AGE75_27405) 14910..16073 + 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
AGE75_RS27410 (AGE75_27410) 16063..16323 + 261 WP_004187310 IcmT/TraK family protein traK
AGE75_RS30755 16348..19653 + 3306 WP_227516140 LPD7 domain-containing protein -
AGE75_RS27420 (AGE75_27420) 19619..20131 + 513 WP_011091071 hypothetical protein traL
AGE75_RS29400 20132..20344 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
AGE75_RS27425 (AGE75_27425) 20316..20726 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AGE75_RS27430 (AGE75_27430) 20794..21507 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AGE75_RS29405 21516..22667 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AGE75_RS27445 (AGE75_27445) 22679..24028 + 1350 WP_004206932 conjugal transfer protein TraO traO
AGE75_RS27450 (AGE75_27450) 24040..24744 + 705 WP_004206933 conjugal transfer protein TraP traP
AGE75_RS27455 (AGE75_27455) 24768..25298 + 531 WP_004187478 conjugal transfer protein TraQ traQ
AGE75_RS27460 (AGE75_27460) 25315..25704 + 390 WP_011154472 DUF6750 family protein traR
AGE75_RS27465 (AGE75_27465) 25750..26244 + 495 WP_004187480 hypothetical protein -
AGE75_RS27470 (AGE75_27470) 26241..29291 + 3051 WP_011154474 conjugative transfer protein traU
AGE75_RS27475 (AGE75_27475) 29288..30496 + 1209 WP_004187486 conjugal transfer protein TraW traW
AGE75_RS27480 (AGE75_27480) 30493..31143 + 651 WP_004187488 hypothetical protein -
AGE75_RS27485 (AGE75_27485) 31136..33316 + 2181 WP_004187492 DotA/TraY family protein traY
AGE75_RS27490 (AGE75_27490) 33319..33972 + 654 WP_004206935 hypothetical protein -
AGE75_RS27495 (AGE75_27495) 34046..34276 + 231 WP_004187496 IncL/M type plasmid replication protein RepC -
AGE75_RS27500 (AGE75_27500) 34561..35628 + 1068 WP_020316718 plasmid replication initiator RepA -
AGE75_RS27505 (AGE75_27505) 36800..37333 - 534 Protein_46 IS110-like element IS4321 family transposase -


Host bacterium


ID   1325 GenBank   NZ_CP017936
Plasmid name   pCAV1016-76 Incompatibility group   IncL/M
Plasmid size   76186 bp Coordinate of oriT [Strand]   11218..11322 [+]
Host baterium   Klebsiella pneumoniae strain CAV1016

Cargo genes


Drug resistance gene   aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, sul1, blaSHV-30
Virulence gene   -
Metal resistance gene   merC, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -