Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100864
Name   oriT_pCAV1015-76 in_silico
Organism   Klebsiella oxytoca strain CAV1015
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP017932 (72439..72543 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pCAV1015-76
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   936 GenBank   WP_004206924
Name   PutativerelaxaseofpCAV1015-76 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1098..18351

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AGF18_RS30610 (AGF18_30610) 1098..1358 + 261 WP_004187310 IcmT/TraK family protein traK
AGF18_RS33920 1383..4688 + 3306 WP_227516140 LPD7 domain-containing protein -
AGF18_RS30620 (AGF18_30620) 4654..5166 + 513 WP_011091071 hypothetical protein traL
AGF18_RS32555 5167..5379 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
AGF18_RS30625 (AGF18_30625) 5351..5761 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AGF18_RS30630 (AGF18_30630) 5829..6542 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AGF18_RS32560 6551..7702 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AGF18_RS30645 (AGF18_30645) 7714..9063 + 1350 WP_004206932 conjugal transfer protein TraO traO
AGF18_RS30650 (AGF18_30650) 9075..9779 + 705 WP_004206933 conjugal transfer protein TraP traP
AGF18_RS30655 (AGF18_30655) 9803..10333 + 531 WP_004187478 conjugal transfer protein TraQ traQ
AGF18_RS30660 (AGF18_30660) 10350..10739 + 390 WP_011154472 DUF6750 family protein traR
AGF18_RS30665 (AGF18_30665) 10785..11279 + 495 WP_004187480 hypothetical protein -
AGF18_RS30670 (AGF18_30670) 11276..14326 + 3051 WP_011154474 conjugative transfer protein traU
AGF18_RS30675 (AGF18_30675) 14323..15531 + 1209 WP_004187486 conjugal transfer protein TraW traW
AGF18_RS30680 (AGF18_30680) 15528..16178 + 651 WP_004187488 hypothetical protein -
AGF18_RS30685 (AGF18_30685) 16171..18351 + 2181 WP_004187492 DotA/TraY family protein traY
AGF18_RS30690 (AGF18_30690) 18354..19007 + 654 WP_004206935 hypothetical protein -
AGF18_RS30695 (AGF18_30695) 19081..19311 + 231 WP_004187496 IncL/M type plasmid replication protein RepC -
AGF18_RS30700 (AGF18_30700) 19608..20663 + 1056 WP_015062846 plasmid replication initiator RepA -
AGF18_RS30705 (AGF18_30705) 21835..22368 - 534 Protein_20 IS110-like element IS4321 family transposase -


Host bacterium


ID   1324 GenBank   NZ_CP017932
Plasmid name   pCAV1015-76 Incompatibility group   IncL/M
Plasmid size   76186 bp Coordinate of oriT [Strand]   72439..72543 [+]
Host baterium   Klebsiella oxytoca strain CAV1015

Cargo genes


Drug resistance gene   aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, sul1, blaSHV-30
Virulence gene   -
Metal resistance gene   merC, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -