Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100862 |
| Name | oriT_pKPGJ-2d  |
| Organism | Klebsiella variicola strain GJ2 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP017853 (54970..55075 [+], 106 nt) |
| oriT length | 106 nt |
| IRs (inverted repeats) | 18..35, 41..58 (GTTTTTGGAGTACCGCCG..CGGCGGCCATCCAAAAAC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 106 nt
>oriT_pKPGJ-2d
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGATGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCATACT
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGATGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCATACT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 934 | GenBank | WP_077138896 |
| Name | PutativerelaxaseofpKPGJ-2d |
UniProt ID | A0A1Q1E692 |
| Length | 659 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 659 a.a. Molecular weight: 75388.24 Da Isoelectric Point: 10.0411
>WP_077138896.1 TraI/MobA(P) family conjugative relaxase [Klebsiella variicola]
MVIPKIIEGRRDKKSSFAQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFSKDTLHQACRLLELKNGWSHSNGAYVVNE
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNFIHVSAGLREAKSWDDVHK
TFADIGLRFEKAQGKKGYVITHEHQNLKTAVKASLVFNKAQYTLKSMEERFGEYQPSRIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPTYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPYTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSLRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSENDDKFKPK
MVIPKIIEGRRDKKSSFAQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFSKDTLHQACRLLELKNGWSHSNGAYVVNE
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNFIHVSAGLREAKSWDDVHK
TFADIGLRFEKAQGKKGYVITHEHQNLKTAVKASLVFNKAQYTLKSMEERFGEYQPSRIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPTYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPYTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSLRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSENDDKFKPK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 24444..52174
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD64_RS29600 (BBD64_27800) | 19749..20069 | + | 321 | WP_021561451 | hypothetical protein | - |
| BBD64_RS29605 (BBD64_27805) | 20072..20920 | + | 849 | WP_060453257 | 3'-5' exonuclease | - |
| BBD64_RS29610 (BBD64_27810) | 20943..22208 | - | 1266 | WP_077138907 | translesion error-prone DNA polymerase V subunit UmuC | - |
| BBD64_RS29615 (BBD64_27815) | 22196..22630 | - | 435 | WP_015062799 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| BBD64_RS29620 (BBD64_27820) | 22783..23436 | - | 654 | WP_039592068 | type II CAAX endopeptidase family protein | - |
| BBD64_RS29625 (BBD64_27825) | 23516..23899 | + | 384 | WP_032451295 | DUF1496 domain-containing protein | - |
| BBD64_RS29630 (BBD64_27830) | 24043..24399 | + | 357 | WP_015586032 | lytic transglycosylase domain-containing protein | - |
| BBD64_RS29635 (BBD64_27835) | 24444..25706 | + | 1263 | WP_032426772 | hypothetical protein | trbA |
| BBD64_RS29640 (BBD64_27840) | 25717..26667 | + | 951 | WP_004187441 | DsbC family protein | trbB |
| BBD64_RS29645 (BBD64_27845) | 26680..28767 | + | 2088 | WP_011091092 | hypothetical protein | - |
| BBD64_RS29650 (BBD64_27850) | 28815..29324 | + | 510 | WP_023302492 | MucR family transcriptional regulator | - |
| BBD64_RS31265 | 29379..29474 | - | 96 | WP_004206884 | DinQ-like type I toxin DqlB | - |
| BBD64_RS29655 (BBD64_27855) | 30699..31754 | - | 1056 | WP_224052343 | plasmid replication initiator RepA | - |
| BBD64_RS29660 (BBD64_27860) | 32051..32281 | - | 231 | WP_011091085 | IncL/M type plasmid replication protein RepC | - |
| BBD64_RS29665 (BBD64_27865) | 32362..33015 | - | 654 | WP_077138906 | hypothetical protein | - |
| BBD64_RS29670 (BBD64_27870) | 33017..35212 | - | 2196 | WP_077138905 | DotA/TraY family protein | traY |
| BBD64_RS29675 (BBD64_27875) | 35205..35801 | - | 597 | WP_077138904 | TraX-like protein | - |
| BBD64_RS29680 (BBD64_27880) | 35798..37006 | - | 1209 | WP_011091082 | conjugal transfer protein TraW | traW |
| BBD64_RS29685 (BBD64_27885) | 37003..40053 | - | 3051 | WP_077138903 | conjugal transfer protein | traU |
| BBD64_RS29690 (BBD64_27890) | 40050..40544 | - | 495 | WP_004187480 | hypothetical protein | - |
| BBD64_RS29695 (BBD64_27895) | 40590..40979 | - | 390 | WP_011154472 | DUF6750 family protein | traR |
| BBD64_RS29700 (BBD64_27900) | 40996..41526 | - | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
| BBD64_RS29705 (BBD64_27905) | 41550..42254 | - | 705 | WP_077138902 | conjugal transfer protein TraP | traP |
| BBD64_RS29710 (BBD64_27910) | 42266..43615 | - | 1350 | WP_077138901 | conjugal transfer protein TraO | traO |
| BBD64_RS29715 | 43627..44778 | - | 1152 | WP_077138900 | DotH/IcmK family type IV secretion protein | traN |
| BBD64_RS29720 (BBD64_27920) | 44787..45500 | - | 714 | WP_227516822 | DotI/IcmL family type IV secretion protein | traM |
| BBD64_RS29725 (BBD64_27925) | 45568..45978 | + | 411 | WP_040027863 | H-NS family nucleoid-associated regulatory protein | - |
| BBD64_RS29730 | 46028..46162 | + | 135 | WP_229654975 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| BBD64_RS29735 (BBD64_27930) | 46163..46675 | - | 513 | WP_011091071 | hypothetical protein | traL |
| BBD64_RS31210 | 46641..49946 | - | 3306 | WP_227516821 | LPD7 domain-containing protein | - |
| BBD64_RS29745 (BBD64_27940) | 49971..50231 | - | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| BBD64_RS29750 (BBD64_27945) | 50221..51384 | - | 1164 | WP_077138898 | plasmid transfer ATPase TraJ | virB11 |
| BBD64_RS29755 (BBD64_27950) | 51395..52174 | - | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| BBD64_RS29760 (BBD64_27955) | 52171..52671 | - | 501 | WP_077138897 | DotD/TraH family lipoprotein | - |
| BBD64_RS29765 (BBD64_27960) | 52685..54664 | - | 1980 | WP_077138896 | TraI/MobA(P) family conjugative relaxase | - |
| BBD64_RS31215 | 54651..55178 | - | 528 | WP_227516820 | plasmid mobilization protein MobA | - |
| BBD64_RS29775 (BBD64_27970) | 55213..55608 | + | 396 | WP_171972704 | MobC | - |
| BBD64_RS29780 (BBD64_27975) | 56108..56644 | - | 537 | WP_077138895 | hypothetical protein | - |
| BBD64_RS29785 (BBD64_27980) | 56777..57088 | - | 312 | WP_011091065 | hypothetical protein | - |
Host bacterium
| ID | 1322 | GenBank | NZ_CP017853 |
| Plasmid name | pKPGJ-2d | Incompatibility group | IncL/M |
| Plasmid size | 58666 bp | Coordinate of oriT [Strand] | 54970..55075 [+] |
| Host baterium | Klebsiella variicola strain GJ2 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |