Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100850 |
| Name | oriT_pKPGJ-1c  |
| Organism | Klebsiella variicola strain GJ1 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP017282 (10791..10896 [+], 106 nt) |
| oriT length | 106 nt |
| IRs (inverted repeats) | 18..35, 41..58 (GTTTTTGGAGTACCGCCG..CGGCGGCCATCCAAAAAC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 106 nt
>oriT_pKPGJ-1c
AGTATGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCATCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT
AGTATGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCATCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 922 | GenBank | WP_077138896 |
| Name | PutativerelaxaseofpKPGJ-1c |
UniProt ID | A0A1Q1E692 |
| Length | 659 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 659 a.a. Molecular weight: 75388.24 Da Isoelectric Point: 10.0411
>WP_077138896.1 TraI/MobA(P) family conjugative relaxase [Klebsiella variicola]
MVIPKIIEGRRDKKSSFAQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFSKDTLHQACRLLELKNGWSHSNGAYVVNE
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNFIHVSAGLREAKSWDDVHK
TFADIGLRFEKAQGKKGYVITHEHQNLKTAVKASLVFNKAQYTLKSMEERFGEYQPSRIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPTYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPYTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSLRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSENDDKFKPK
MVIPKIIEGRRDKKSSFAQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFSKDTLHQACRLLELKNGWSHSNGAYVVNE
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNFIHVSAGLREAKSWDDVHK
TFADIGLRFEKAQGKKGYVITHEHQNLKTAVKASLVFNKAQYTLKSMEERFGEYQPSRIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPTYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPYTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSLRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSENDDKFKPK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 13692..41422
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD63_RS00635 (BBD63_27340) | 8778..9089 | + | 312 | WP_011091065 | hypothetical protein | - |
| BBD63_RS00640 (BBD63_27345) | 9222..9758 | + | 537 | WP_077138895 | hypothetical protein | - |
| BBD63_RS00645 (BBD63_27350) | 10258..10653 | - | 396 | WP_171972704 | MobC | - |
| BBD63_RS30905 | 10688..11215 | + | 528 | WP_227516820 | plasmid mobilization protein MobA | - |
| BBD63_RS00655 (BBD63_27360) | 11202..13181 | + | 1980 | WP_077138896 | TraI/MobA(P) family conjugative relaxase | - |
| BBD63_RS00660 (BBD63_27365) | 13195..13695 | + | 501 | WP_077138897 | DotD/TraH family lipoprotein | - |
| BBD63_RS00665 (BBD63_27370) | 13692..14471 | + | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| BBD63_RS00670 (BBD63_27375) | 14482..15645 | + | 1164 | WP_077138898 | plasmid transfer ATPase TraJ | virB11 |
| BBD63_RS00675 (BBD63_27380) | 15635..15895 | + | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| BBD63_RS30910 | 15920..19225 | + | 3306 | WP_227516821 | LPD7 domain-containing protein | - |
| BBD63_RS00685 (BBD63_27390) | 19191..19703 | + | 513 | WP_011091071 | hypothetical protein | traL |
| BBD63_RS00690 | 19704..19916 | - | 213 | WP_306458688 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| BBD63_RS00695 (BBD63_27395) | 19888..20298 | - | 411 | WP_040027863 | H-NS family nucleoid-associated regulatory protein | - |
| BBD63_RS00700 (BBD63_27400) | 20366..21079 | + | 714 | WP_227516822 | DotI/IcmL family type IV secretion protein | traM |
| BBD63_RS00705 | 21088..22239 | + | 1152 | WP_077138900 | DotH/IcmK family type IV secretion protein | traN |
| BBD63_RS00710 (BBD63_27410) | 22251..23600 | + | 1350 | WP_077138901 | conjugal transfer protein TraO | traO |
| BBD63_RS00715 (BBD63_27415) | 23612..24316 | + | 705 | WP_077138902 | conjugal transfer protein TraP | traP |
| BBD63_RS00720 (BBD63_27420) | 24340..24870 | + | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
| BBD63_RS00725 (BBD63_27425) | 24887..25276 | + | 390 | WP_011154472 | DUF6750 family protein | traR |
| BBD63_RS00730 (BBD63_27430) | 25322..25816 | + | 495 | WP_004187480 | hypothetical protein | - |
| BBD63_RS00735 (BBD63_27435) | 25813..28863 | + | 3051 | WP_077138903 | conjugal transfer protein | traU |
| BBD63_RS00740 (BBD63_27440) | 28860..30068 | + | 1209 | WP_011091082 | conjugal transfer protein TraW | traW |
| BBD63_RS00745 (BBD63_27445) | 30065..30661 | + | 597 | WP_077138904 | TraX-like protein | - |
| BBD63_RS00750 (BBD63_27450) | 30654..32849 | + | 2196 | WP_077138905 | DotA/TraY family protein | traY |
| BBD63_RS00755 (BBD63_27455) | 32851..33504 | + | 654 | WP_077138906 | hypothetical protein | - |
| BBD63_RS00760 (BBD63_27460) | 33573..33815 | + | 243 | WP_023893611 | IncL/M type plasmid replication protein RepC | - |
| BBD63_RS00765 (BBD63_27465) | 34112..35167 | + | 1056 | WP_224052343 | plasmid replication initiator RepA | - |
| BBD63_RS31255 | 36392..36487 | + | 96 | WP_004206884 | DinQ-like type I toxin DqlB | - |
| BBD63_RS00770 (BBD63_27470) | 36542..37051 | - | 510 | WP_023302492 | MucR family transcriptional regulator | - |
| BBD63_RS00775 (BBD63_27475) | 37099..39186 | - | 2088 | WP_011091092 | hypothetical protein | - |
| BBD63_RS00780 (BBD63_27480) | 39199..40149 | - | 951 | WP_004187441 | DsbC family protein | trbB |
| BBD63_RS00785 (BBD63_27485) | 40160..41422 | - | 1263 | WP_032426772 | hypothetical protein | trbA |
| BBD63_RS00790 (BBD63_27490) | 41467..41823 | - | 357 | WP_015586032 | lytic transglycosylase domain-containing protein | - |
| BBD63_RS00795 (BBD63_27495) | 41967..42350 | - | 384 | WP_032451295 | DUF1496 domain-containing protein | - |
| BBD63_RS00800 (BBD63_27500) | 42430..43083 | + | 654 | WP_039592068 | type II CAAX endopeptidase family protein | - |
| BBD63_RS00805 (BBD63_27505) | 43236..43670 | + | 435 | WP_015062799 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| BBD63_RS00810 (BBD63_27510) | 43658..44923 | + | 1266 | WP_077138907 | translesion error-prone DNA polymerase V subunit UmuC | - |
| BBD63_RS00815 (BBD63_27515) | 44946..45794 | - | 849 | WP_060453257 | 3'-5' exonuclease | - |
| BBD63_RS00820 (BBD63_27520) | 45797..46117 | - | 321 | WP_021561451 | hypothetical protein | - |
Host bacterium
| ID | 1310 | GenBank | NZ_CP017282 |
| Plasmid name | pKPGJ-1c | Incompatibility group | IncL/M |
| Plasmid size | 58666 bp | Coordinate of oriT [Strand] | 10791..10896 [+] |
| Host baterium | Klebsiella variicola strain GJ1 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |