Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100834
Name   oriT_pSH14-009_99 in_silico
Organism   Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-009
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP016585 (45599..45701 [-], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pSH14-009_99
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   906 GenBank   WP_001354015
Name   NikB_pSH14-009_99 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 51067..89366

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A6W14_RS23490 (A6W14_23245) 48783..51074 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
A6W14_RS23495 (A6W14_23250) 51067..52137 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
A6W14_RS23500 (A6W14_23255) 52156..53364 - 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
A6W14_RS23505 (A6W14_23260) 53656..53808 + 153 WP_001331364 Hok/Gef family protein -
A6W14_RS26480 53880..54071 - 192 WP_174715448 hypothetical protein -
A6W14_RS26485 54632..54727 + 96 WP_000609148 DinQ-like type I toxin DqlB -
A6W14_RS26490 54792..54968 - 177 WP_001054904 hypothetical protein -
A6W14_RS23515 (A6W14_23270) 55360..55569 + 210 WP_000062603 HEAT repeat domain-containing protein -
A6W14_RS23520 (A6W14_23275) 55641..56303 - 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
A6W14_RS23525 (A6W14_23280) 56368..58530 - 2163 WP_000698351 DotA/TraY family protein traY
A6W14_RS23530 (A6W14_23285) 58627..59211 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
A6W14_RS23535 (A6W14_23290) 59240..60442 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
A6W14_RS25280 60409..61023 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
A6W14_RS23540 (A6W14_23295) 61023..64067 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
A6W14_RS23545 (A6W14_23300) 64157..64957 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
A6W14_RS23550 (A6W14_23305) 64941..65129 - 189 WP_001277255 putative conjugal transfer protein TraS -
A6W14_RS23555 (A6W14_23310) 65193..65597 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
A6W14_RS23560 (A6W14_23315) 65648..66175 - 528 WP_001055569 conjugal transfer protein TraQ traQ
A6W14_RS23565 (A6W14_23320) 66175..66879 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
A6W14_RS23570 (A6W14_23325) 66879..68168 - 1290 WP_001272005 conjugal transfer protein TraO traO
A6W14_RS23575 (A6W14_23330) 68171..69154 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
A6W14_RS23580 (A6W14_23335) 69165..69857 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
A6W14_RS23585 (A6W14_23340) 69854..70201 - 348 WP_001055900 conjugal transfer protein traL
A6W14_RS23590 (A6W14_23345) 70219..73986 - 3768 WP_001141529 LPD7 domain-containing protein -
A6W14_RS23595 (A6W14_23350) 74076..74627 - 552 WP_000014583 phospholipase D family protein -
A6W14_RS25285 74642..74932 - 291 WP_001299214 hypothetical protein traK
A6W14_RS23600 (A6W14_23355) 74929..76077 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
A6W14_RS23605 (A6W14_23360) 76074..76892 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
A6W14_RS23610 (A6W14_23365) 76889..77347 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
A6W14_RS23615 (A6W14_23370) 77742..78326 - 585 WP_000977522 histidine phosphatase family protein -
A6W14_RS23620 (A6W14_23375) 78386..79588 - 1203 WP_000976351 conjugal transfer protein TraF -
A6W14_RS23625 (A6W14_23380) 79673..80497 - 825 WP_001238939 conjugal transfer protein TraE traE
A6W14_RS23630 (A6W14_23385) 80648..81802 - 1155 WP_001139957 site-specific integrase -
A6W14_RS26495 81801..82154 + 354 WP_001393368 hypothetical protein -
A6W14_RS26130 83323..83571 + 249 WP_001349157 hypothetical protein -
A6W14_RS23640 (A6W14_23395) 83568..84860 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
A6W14_RS25320 84860..85516 - 657 WP_001193553 prepilin peptidase -
A6W14_RS23645 (A6W14_23400) 85501..86061 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
A6W14_RS23650 (A6W14_23405) 86071..86685 - 615 WP_000959785 type 4 pilus major pilin -
A6W14_RS23655 (A6W14_23410) 86703..87800 - 1098 WP_001208805 type II secretion system F family protein -
A6W14_RS23660 (A6W14_23415) 87813..89366 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
A6W14_RS23665 (A6W14_23420) 89377..89829 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
A6W14_RS23670 (A6W14_23425) 89816..91111 - 1296 WP_000752774 type 4b pilus protein PilO2 -
A6W14_RS23675 (A6W14_23430) 91104..92786 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
A6W14_RS23680 (A6W14_23435) 92800..93237 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
A6W14_RS25325 93237..94304 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1294 GenBank   NZ_CP016585
Plasmid name   pSH14-009_99 Incompatibility group   IncI1
Plasmid size   99473 bp Coordinate of oriT [Strand]   45599..45701 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-009

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   mercury resistance
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -