Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100834 |
Name | oriT_pSH14-009_99 |
Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-009 |
Sequence Completeness | intact |
NCBI accession of oriT (coordinates [strand]) | NZ_CP016585 (45599..45701 [-], 103 nt) |
oriT length | 103 nt |
IRs (inverted repeats) | IR1: 19..26, 30..37 (GTCGGGGC..GCCCTGAC) IR2: 44..58, 67..81 (GCAATTGTATAATCG..CGGTTATACAATTGC) |
Location of nic site | 89..90 |
Conserved sequence flanking the nic site |
CATCCTG|T |
Note | predicted by the oriTfinder |
oriT sequence
Download Length: 103 nt
>oriT_pSH14-009_99
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 906 | GenBank | WP_001354015 |
Name | NikB_pSH14-009_99 | UniProt ID | _ |
Length | 899 a.a. | PDB ID | |
Note | putative relaxase |
Relaxase protein sequence
Download Length: 899 a.a. Molecular weight: 104018.47 Da Isoelectric Point: 7.3526
>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 51067..89366
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6W14_RS23490 (A6W14_23245) | 48783..51074 | - | 2292 | WP_001289276 | F-type conjugative transfer protein TrbC | - |
A6W14_RS23495 (A6W14_23250) | 51067..52137 | - | 1071 | WP_000151583 | IncI1-type conjugal transfer protein TrbB | trbB |
A6W14_RS23500 (A6W14_23255) | 52156..53364 | - | 1209 | WP_000121274 | IncI1-type conjugal transfer protein TrbA | trbA |
A6W14_RS23505 (A6W14_23260) | 53656..53808 | + | 153 | WP_001331364 | Hok/Gef family protein | - |
A6W14_RS26480 | 53880..54071 | - | 192 | WP_174715448 | hypothetical protein | - |
A6W14_RS26485 | 54632..54727 | + | 96 | WP_000609148 | DinQ-like type I toxin DqlB | - |
A6W14_RS26490 | 54792..54968 | - | 177 | WP_001054904 | hypothetical protein | - |
A6W14_RS23515 (A6W14_23270) | 55360..55569 | + | 210 | WP_000062603 | HEAT repeat domain-containing protein | - |
A6W14_RS23520 (A6W14_23275) | 55641..56303 | - | 663 | WP_000653334 | plasmid IncI1-type surface exclusion protein ExcA | - |
A6W14_RS23525 (A6W14_23280) | 56368..58530 | - | 2163 | WP_000698351 | DotA/TraY family protein | traY |
A6W14_RS23530 (A6W14_23285) | 58627..59211 | - | 585 | WP_001037987 | IncI1-type conjugal transfer protein TraX | - |
A6W14_RS23535 (A6W14_23290) | 59240..60442 | - | 1203 | WP_001189160 | IncI1-type conjugal transfer protein TraW | traW |
A6W14_RS25280 | 60409..61023 | - | 615 | WP_000337398 | IncI1-type conjugal transfer protein TraV | traV |
A6W14_RS23540 (A6W14_23295) | 61023..64067 | - | 3045 | WP_001024780 | IncI1-type conjugal transfer protein TraU | traU |
A6W14_RS23545 (A6W14_23300) | 64157..64957 | - | 801 | WP_001164788 | IncI1-type conjugal transfer protein TraT | traT |
A6W14_RS23550 (A6W14_23305) | 64941..65129 | - | 189 | WP_001277255 | putative conjugal transfer protein TraS | - |
A6W14_RS23555 (A6W14_23310) | 65193..65597 | - | 405 | WP_000086957 | IncI1-type conjugal transfer protein TraR | traR |
A6W14_RS23560 (A6W14_23315) | 65648..66175 | - | 528 | WP_001055569 | conjugal transfer protein TraQ | traQ |
A6W14_RS23565 (A6W14_23320) | 66175..66879 | - | 705 | WP_000801920 | IncI1-type conjugal transfer protein TraP | traP |
A6W14_RS23570 (A6W14_23325) | 66879..68168 | - | 1290 | WP_001272005 | conjugal transfer protein TraO | traO |
A6W14_RS23575 (A6W14_23330) | 68171..69154 | - | 984 | WP_001191877 | IncI1-type conjugal transfer protein TraN | traN |
A6W14_RS23580 (A6W14_23335) | 69165..69857 | - | 693 | WP_000138548 | DotI/IcmL family type IV secretion protein | traM |
A6W14_RS23585 (A6W14_23340) | 69854..70201 | - | 348 | WP_001055900 | conjugal transfer protein | traL |
A6W14_RS23590 (A6W14_23345) | 70219..73986 | - | 3768 | WP_001141529 | LPD7 domain-containing protein | - |
A6W14_RS23595 (A6W14_23350) | 74076..74627 | - | 552 | WP_000014583 | phospholipase D family protein | - |
A6W14_RS25285 | 74642..74932 | - | 291 | WP_001299214 | hypothetical protein | traK |
A6W14_RS23600 (A6W14_23355) | 74929..76077 | - | 1149 | WP_001024972 | plasmid transfer ATPase TraJ | virB11 |
A6W14_RS23605 (A6W14_23360) | 76074..76892 | - | 819 | WP_000646098 | IncI1-type conjugal transfer lipoprotein TraI | traI |
A6W14_RS23610 (A6W14_23365) | 76889..77347 | - | 459 | WP_001079808 | IncI1-type conjugal transfer lipoprotein TraH | - |
A6W14_RS23615 (A6W14_23370) | 77742..78326 | - | 585 | WP_000977522 | histidine phosphatase family protein | - |
A6W14_RS23620 (A6W14_23375) | 78386..79588 | - | 1203 | WP_000976351 | conjugal transfer protein TraF | - |
A6W14_RS23625 (A6W14_23380) | 79673..80497 | - | 825 | WP_001238939 | conjugal transfer protein TraE | traE |
A6W14_RS23630 (A6W14_23385) | 80648..81802 | - | 1155 | WP_001139957 | site-specific integrase | - |
A6W14_RS26495 | 81801..82154 | + | 354 | WP_001393368 | hypothetical protein | - |
A6W14_RS26130 | 83323..83571 | + | 249 | WP_001349157 | hypothetical protein | - |
A6W14_RS23640 (A6W14_23395) | 83568..84860 | - | 1293 | WP_001417545 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
A6W14_RS25320 | 84860..85516 | - | 657 | WP_001193553 | prepilin peptidase | - |
A6W14_RS23645 (A6W14_23400) | 85501..86061 | - | 561 | WP_000014116 | lytic transglycosylase domain-containing protein | virB1 |
A6W14_RS23650 (A6W14_23405) | 86071..86685 | - | 615 | WP_000959785 | type 4 pilus major pilin | - |
A6W14_RS23655 (A6W14_23410) | 86703..87800 | - | 1098 | WP_001208805 | type II secretion system F family protein | - |
A6W14_RS23660 (A6W14_23415) | 87813..89366 | - | 1554 | WP_000362202 | ATPase, T2SS/T4P/T4SS family | virB11 |
A6W14_RS23665 (A6W14_23420) | 89377..89829 | - | 453 | WP_001247336 | type IV pilus biogenesis protein PilP | - |
A6W14_RS23670 (A6W14_23425) | 89816..91111 | - | 1296 | WP_000752774 | type 4b pilus protein PilO2 | - |
A6W14_RS23675 (A6W14_23430) | 91104..92786 | - | 1683 | WP_000748143 | PilN family type IVB pilus formation outer membrane protein | - |
A6W14_RS23680 (A6W14_23435) | 92800..93237 | - | 438 | WP_000539807 | type IV pilus biogenesis protein PilM | - |
A6W14_RS25325 | 93237..94304 | - | 1068 | WP_000742600 | type IV pilus biogenesis lipoprotein PilL | - |
Host bacterium
ID | 1294 | GenBank | NZ_CP016585 |
Plasmid name | pSH14-009_99 | Incompatibility group | IncI1 |
Plasmid size | 99473 bp | Coordinate of oriT [Strand] | 45599..45701 [-] |
Host baterium | Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-009 |
Cargo genes
Drug resistance gene | - |
Virulence gene | - |
Metal resistance gene | mercury resistance |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |