Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100827
Name   oriT_pCE-R2-11-0435_92 in_silico
Organism   Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP016520 (38923..39032 [+], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GTAATTGTAATAGCGTC..GACGGTATTACAATTAC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pCE-R2-11-0435_92
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   899 GenBank   WP_001405892
Name   NikB_pCE-R2-11-0435_92 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103883.32 Da        Isoelectric Point: 7.3373

>WP_001405892.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 44392..82680

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BAT85_RS23425 (BAT85_23190) 42108..44399 - 2292 WP_001289282 F-type conjugative transfer protein TrbC -
BAT85_RS23430 (BAT85_23195) 44392..45462 - 1071 WP_000151582 IncI1-type conjugal transfer protein TrbB trbB
BAT85_RS23435 (BAT85_23200) 45481..46689 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
BAT85_RS23440 (BAT85_23205) 46981..47133 + 153 WP_001303307 Hok/Gef family protein -
BAT85_RS23445 (BAT85_23210) 47205..47456 - 252 WP_001291965 hypothetical protein -
BAT85_RS26505 47955..48050 + 96 WP_001303310 DinQ-like type I toxin DqlB -
BAT85_RS26175 48115..48291 - 177 WP_001054897 hypothetical protein -
BAT85_RS23450 (BAT85_23215) 48683..48892 + 210 WP_000062603 HEAT repeat domain-containing protein -
BAT85_RS23455 (BAT85_23220) 48964..49614 - 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
BAT85_RS23460 (BAT85_23225) 49688..51856 - 2169 WP_000698357 DotA/TraY family protein traY
BAT85_RS23465 (BAT85_23230) 51953..52537 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
BAT85_RS23470 (BAT85_23235) 52566..53768 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
BAT85_RS25200 53735..54349 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
BAT85_RS23475 (BAT85_23240) 54349..57393 - 3045 WP_065641822 IncI1-type conjugal transfer protein TraU traU
BAT85_RS23480 (BAT85_23245) 57483..58283 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
BAT85_RS23485 (BAT85_23250) 58267..58455 - 189 WP_001277255 putative conjugal transfer protein TraS -
BAT85_RS23490 (BAT85_23255) 58519..58923 - 405 WP_000086959 IncI1-type conjugal transfer protein TraR traR
BAT85_RS23495 (BAT85_23260) 58974..59501 - 528 WP_001055569 conjugal transfer protein TraQ traQ
BAT85_RS23500 (BAT85_23265) 59501..60205 - 705 WP_000801919 IncI1-type conjugal transfer protein TraP traP
BAT85_RS23505 (BAT85_23270) 60205..61494 - 1290 WP_001272000 conjugal transfer protein TraO traO
BAT85_RS23510 (BAT85_23275) 61497..62480 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
BAT85_RS23515 (BAT85_23280) 62491..63183 - 693 WP_000138551 DotI/IcmL family type IV secretion protein traM
BAT85_RS23520 (BAT85_23285) 63180..63527 - 348 WP_001055900 conjugal transfer protein traL
BAT85_RS23525 (BAT85_23290) 63545..67312 - 3768 WP_001141542 LPD7 domain-containing protein -
BAT85_RS23530 (BAT85_23295) 67402..67953 - 552 WP_000014584 phospholipase D family protein -
BAT85_RS25205 67968..68258 - 291 WP_001372180 hypothetical protein traK
BAT85_RS23535 (BAT85_23300) 68255..69403 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
BAT85_RS23540 (BAT85_23305) 69400..70218 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
BAT85_RS23545 (BAT85_23310) 70215..70673 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
BAT85_RS23550 (BAT85_23315) 71068..71652 - 585 WP_000977522 histidine phosphatase family protein -
BAT85_RS23555 (BAT85_23320) 71712..72914 - 1203 WP_000976353 conjugal transfer protein TraF -
BAT85_RS23560 (BAT85_23325) 73000..73824 - 825 WP_001545755 conjugal transfer protein TraE traE
BAT85_RS23565 (BAT85_23330) 73975..75129 - 1155 WP_001139958 site-specific integrase -
BAT85_RS26415 75128..75481 + 354 WP_001393368 hypothetical protein -
BAT85_RS26040 76650..76898 + 249 WP_001349157 hypothetical protein -
BAT85_RS23570 (BAT85_23335) 76895..78187 - 1293 WP_001619585 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BAT85_RS23575 (BAT85_23340) 78187..78843 - 657 WP_001193549 A24 family peptidase -
BAT85_RS23580 (BAT85_23345) 78828..79388 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
BAT85_RS23585 (BAT85_23350) 79398..80012 - 615 WP_000908226 type 4 pilus major pilin -
BAT85_RS23590 (BAT85_23355) 80029..81114 - 1086 WP_001208802 type II secretion system F family protein -
BAT85_RS23595 (BAT85_23360) 81127..82680 - 1554 WP_000362206 ATPase, T2SS/T4P/T4SS family virB11
BAT85_RS23600 (BAT85_23365) 82691..83143 - 453 WP_001247337 type IV pilus biogenesis protein PilP -
BAT85_RS23605 (BAT85_23370) 83130..84425 - 1296 WP_000752780 type 4b pilus protein PilO2 -
BAT85_RS23610 (BAT85_23375) 84418..86100 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
BAT85_RS23615 (BAT85_23380) 86114..86551 - 438 WP_000539806 type IV pilus biogenesis protein PilM -
BAT85_RS25245 86551..87618 - 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1287 GenBank   NZ_CP016520
Plasmid name   pCE-R2-11-0435_92 Incompatibility group   IncI1
Plasmid size   92323 bp Coordinate of oriT [Strand]   38923..39032 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -