Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100812
Name   oriT_pS51_1 in_silico
Organism   Escherichia coli strain S51
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP015996 (39153..39255 [+], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site    		  CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pS51_1
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   884 GenBank   WP_001354015
Name   NikB_pS51_1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 7965..33787

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A9K64_RS25055 (A9K64_25055) 3056..4210 + 1155 WP_001139957 site-specific integrase -
A9K64_RS25060 (A9K64_25060) 4361..5184 + 824 Protein_4 conjugal transfer protein TraE -
A9K64_RS25065 (A9K64_25065) 5269..6471 + 1203 WP_000976351 conjugal transfer protein TraF -
A9K64_RS25070 (A9K64_25070) 6531..7115 + 585 WP_000977522 histidine phosphatase family protein -
A9K64_RS25075 (A9K64_25075) 7510..7968 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
A9K64_RS25080 (A9K64_25080) 7965..8783 + 819 WP_064638599 IncI1-type conjugal transfer lipoprotein TraI traI
A9K64_RS25085 (A9K64_25085) 8780..9928 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
A9K64_RS27935 9925..10215 + 291 WP_001299214 hypothetical protein traK
A9K64_RS25090 (A9K64_25090) 10230..10781 + 552 WP_000014583 phospholipase D family protein -
A9K64_RS25095 (A9K64_25095) 10870..14635 + 3766 Protein_12 LPD7 domain-containing protein -
A9K64_RS25100 (A9K64_25100) 14653..15000 + 348 WP_001055900 conjugal transfer protein traL
A9K64_RS25105 (A9K64_25105) 14997..15689 + 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
A9K64_RS25110 (A9K64_25110) 15700..16683 + 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
A9K64_RS25115 (A9K64_25115) 16686..17975 + 1290 WP_001272005 conjugal transfer protein TraO traO
A9K64_RS25120 (A9K64_25120) 17975..18679 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
A9K64_RS25125 (A9K64_25125) 18679..19206 + 528 WP_001055569 conjugal transfer protein TraQ traQ
A9K64_RS25130 (A9K64_25130) 19257..19661 + 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
A9K64_RS25135 (A9K64_25135) 19725..19913 + 189 WP_001277255 putative conjugal transfer protein TraS -
A9K64_RS25140 (A9K64_25140) 19897..20697 + 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
A9K64_RS25145 (A9K64_25145) 20787..23831 + 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
A9K64_RS25150 (A9K64_25150) 23831..24445 + 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
A9K64_RS25155 (A9K64_25155) 24412..25614 + 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
A9K64_RS25160 (A9K64_25160) 25643..26227 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
A9K64_RS25165 (A9K64_25165) 26324..28486 + 2163 WP_000698351 DotA/TraY family protein traY
A9K64_RS25170 (A9K64_25170) 28551..29213 + 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
A9K64_RS25175 (A9K64_25175) 29285..29494 - 210 WP_000062603 HEAT repeat domain-containing protein -
A9K64_RS29525 (A9K64_25185) 29886..30062 + 177 WP_001054904 hypothetical protein -
A9K64_RS30100 30127..30222 - 96 WP_000609148 DinQ-like type I toxin DqlB -
A9K64_RS30185 30783..30974 + 192 WP_174715448 hypothetical protein -
A9K64_RS25195 (A9K64_25195) 31046..31198 - 153 WP_001331364 Hok/Gef family protein -
A9K64_RS25200 (A9K64_25200) 31490..32698 + 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
A9K64_RS25205 (A9K64_25205) 32717..33787 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
A9K64_RS25210 (A9K64_25210) 33780..36071 + 2292 WP_001289276 F-type conjugative transfer protein TrbC -

Host bacterium

ID   1272 GenBank   NZ_CP015996
Plasmid name   pS51_1 Incompatibility group   IncI1
Plasmid size   93029 bp Coordinate of oriT [Strand]   39153..39255 [+]
Host baterium   Escherichia coli strain S51

Cargo genes

Drug resistance gene   blaTEM-1A
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -