Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100803
Name   oriT_pSKGH01-3 in_silico
Organism   Klebsiella pneumoniae strain SKGH01
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP015503 (5353..5902 [-], 550 nt)
oriT length   550 nt
IRs (inverted repeats)      243..255, 257..269  (TATTTAATAATTC..GAATTATTAAATA)
 311..318, 321..328  (GCAAAAAC..GTTTTTGC)
Location of nic site      337..338
Conserved sequence flanking the
  nic site    		  GTAGTGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 550 nt

>oriT_pSKGH01-3
TTACTCTGGCCATAAGATAAAACCTTTCATTATTAAGCAATGAACTTTTCACTATAAATATGCATATAGTGTTTACAAGTAAGAAAGACACTCCTAGCAGCGCCTCTAGGATCATCCTATAAAAAAATGCGATCCGGCGCTAGGGGCGTCCCTAATATATATCAATGTTTTTCATGAAAATTGTCAGTACTGATCCTAATAAGAGTCGCTATAGGGTCGTAACAGGATCGCCAACGACTCTCTATTTAATAATTCAGAATTATTAAATATAAATAGCGTTTGTTAATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTGATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   875 GenBank   WP_000948354
Name   TraI_pSKGH01-3 insolico UniProt ID   _
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191683.22 Da        Isoelectric Point: 5.6912

>WP_000948354.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQDPQLHTHVVVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEA
LGYETEVVGKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMVFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGETFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDSSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRADITEREAALPESVLRESQREQEAVREVARENLLQERLQQIERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

DNA helicase TraI (TraI_C)

(1434-1557)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

TrwC relaxase (TrwC)

(10-283)

AAA domain (AAA_30)

(968-1156)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 4965..33108

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A7B01_RS29225 (A7B01_29230) 937..1371 + 435 WP_000845953 conjugation system SOS inhibitor PsiB -
A7B01_RS29230 (A7B01_29235) 1368..2087 + 720 WP_001276217 plasmid SOS inhibition protein A -
A7B01_RS34200 2309..2458 + 150 Protein_3 plasmid maintenance protein Mok -
A7B01_RS31865 2400..2525 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
A7B01_RS33755 (A7B01_29240) 2844..3140 - 297 Protein_5 hypothetical protein -
A7B01_RS29240 (A7B01_29245) 3440..3736 + 297 WP_001272251 hypothetical protein -
A7B01_RS29245 (A7B01_29250) 3847..4668 + 822 WP_001234445 DUF932 domain-containing protein -
A7B01_RS29250 (A7B01_29255) 4965..5555 - 591 WP_000252683 transglycosylase SLT domain-containing protein virB1
A7B01_RS29255 (A7B01_29260) 5890..6273 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
A7B01_RS29260 (A7B01_29265) 6467..7138 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
A7B01_RS29265 (A7B01_29270) 7275..7502 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
A7B01_RS29270 (A7B01_29275) 7535..7894 + 360 WP_001098992 type IV conjugative transfer system pilin TraA -
A7B01_RS29275 (A7B01_29280) 7909..8220 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
A7B01_RS29280 (A7B01_29285) 8242..8808 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
A7B01_RS29285 (A7B01_29290) 8795..9523 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
A7B01_RS29290 (A7B01_29295) 9523..10974 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
A7B01_RS29295 (A7B01_29300) 10964..11530 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
A7B01_RS31885 11517..11837 + 321 WP_001057307 conjugal transfer protein TrbD -
A7B01_RS29300 (A7B01_29305) 11834..12349 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
A7B01_RS31890 12484..12705 + 222 WP_001278683 conjugal transfer protein TraR -
A7B01_RS29305 (A7B01_29310) 12698..13174 + 477 WP_000549587 hypothetical protein -
A7B01_RS29310 (A7B01_29315) 13254..13472 + 219 WP_000556745 hypothetical protein -
A7B01_RS29315 (A7B01_29320) 13500..13847 + 348 WP_000836682 hypothetical protein -
A7B01_RS29320 (A7B01_29325) 13973..16603 + 2631 WP_000069777 type IV secretion system protein TraC virb4
A7B01_RS29325 (A7B01_29330) 16600..16986 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
A7B01_RS29330 (A7B01_29335) 16983..17615 + 633 WP_001203728 type-F conjugative transfer system protein TraW traW
A7B01_RS29335 (A7B01_29340) 17612..18604 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
A7B01_RS29340 (A7B01_29345) 18634..18939 + 306 WP_000224416 hypothetical protein -
A7B01_RS29345 (A7B01_29350) 18948..19586 + 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
A7B01_RS29350 (A7B01_29355) 19583..21433 + 1851 WP_000821856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
A7B01_RS29355 (A7B01_29360) 21460..21717 + 258 WP_000864353 conjugal transfer protein TrbE -
A7B01_RS29360 (A7B01_29365) 21704..22453 + 750 WP_001336806 type-F conjugative transfer system pilin assembly protein TraF traF
A7B01_RS31895 22467..22811 + 345 WP_000556796 conjugal transfer protein TrbA -
A7B01_RS29365 (A7B01_29370) 22930..23214 + 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
A7B01_RS29370 (A7B01_29375) 23201..23746 + 546 WP_000059831 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
A7B01_RS31900 23676..24023 + 348 WP_001309242 P-type conjugative transfer protein TrbJ -
A7B01_RS29375 (A7B01_29380) 24004..24396 + 393 WP_000660699 F-type conjugal transfer protein TrbF -
A7B01_RS29380 (A7B01_29385) 24374..25756 + 1383 WP_001309243 conjugal transfer pilus assembly protein TraH traH
A7B01_RS29385 (A7B01_29390) 25753..28575 + 2823 WP_001007039 conjugal transfer mating-pair stabilization protein TraG traG
A7B01_RS31905 28591..29076 + 486 WP_000605870 hypothetical protein -
A7B01_RS29390 (A7B01_29395) 29125..29856 + 732 WP_000782451 conjugal transfer complement resistance protein TraT -
A7B01_RS29395 (A7B01_29400) 30059..30796 + 738 WP_000199905 hypothetical protein -
A7B01_RS29400 (A7B01_29405) 30847..33108 + 2262 WP_046072940 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   1263 GenBank   NZ_CP015503
Plasmid name   pSKGH01-3 Incompatibility group   IncFII
Plasmid size   84941 bp Coordinate of oriT [Strand]   5353..5902 [-]
Host baterium   Klebsiella pneumoniae strain SKGH01

Cargo genes

Drug resistance gene   rmtF, aadA2, dfrA12
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIF11