Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100802
Name   oriT_CR14_p2 in_silico
Organism   Klebsiella pneumoniae strain CR14
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP015394 (48342..48892 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_CR14_p2
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   874 GenBank   WP_001337757
Name   TraI_CR14_p2 insolico UniProt ID   _
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>WP_001337757.1 MULTISPECIES: MobH family relaxase [Gammaproteobacteria]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 46476..71667

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A6P37_RS28920 (A6P37_28585) 42501..42734 - 234 WP_001191892 hypothetical protein -
A6P37_RS28925 (A6P37_28590) 42716..43333 - 618 WP_001249396 hypothetical protein -
A6P37_RS28930 (A6P37_28595) 43501..46479 + 2979 WP_001337757 MobH family relaxase -
A6P37_RS28935 (A6P37_28600) 46476..48341 + 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
A6P37_RS28940 (A6P37_28605) 48391..48936 + 546 WP_000228720 hypothetical protein -
A6P37_RS28945 (A6P37_28610) 48893..49522 + 630 WP_000743450 DUF4400 domain-containing protein tfc7
A6P37_RS28950 (A6P37_28615) 49532..49978 + 447 WP_000122506 hypothetical protein -
A6P37_RS28955 (A6P37_28620) 49988..50365 + 378 WP_000869261 hypothetical protein -
A6P37_RS28960 (A6P37_28625) 50365..51027 + 663 WP_001231463 hypothetical protein -
A6P37_RS32185 51208..51351 + 144 WP_001275801 hypothetical protein -
A6P37_RS28965 (A6P37_28630) 51363..51728 + 366 WP_001052531 hypothetical protein -
A6P37_RS28970 (A6P37_28635) 51873..52154 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
A6P37_RS28975 (A6P37_28640) 52151..52777 + 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
A6P37_RS28980 (A6P37_28645) 52761..53678 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
A6P37_RS28985 (A6P37_28650) 53678..54991 + 1314 WP_024131605 TraB/VirB10 family protein traB
A6P37_RS28990 (A6P37_28655) 54988..55566 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
A6P37_RS28995 (A6P37_28660) 55570..55962 + 393 WP_000479535 TraA family conjugative transfer protein -
A6P37_RS29000 (A6P37_28665) 56163..61694 + 5532 WP_000606833 Ig-like domain-containing protein -
A6P37_RS29005 (A6P37_28670) 61843..62550 + 708 WP_001259347 DsbC family protein -
A6P37_RS29010 (A6P37_28675) 62547..64994 + 2448 WP_000637386 type IV secretion system protein TraC virb4
A6P37_RS29015 (A6P37_28680) 65009..65326 + 318 WP_000351984 hypothetical protein -
A6P37_RS29020 (A6P37_28685) 65323..65853 + 531 WP_001010738 S26 family signal peptidase -
A6P37_RS29025 (A6P37_28690) 65816..67081 + 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
A6P37_RS29030 (A6P37_28695) 67078..67749 + 672 WP_001337754 EAL domain-containing protein -
A6P37_RS29035 (A6P37_28700) 67749..68753 + 1005 WP_043940352 TraU family protein traU
A6P37_RS29040 (A6P37_28705) 68869..71667 + 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
A6P37_RS29045 (A6P37_28710) 71706..72566 - 861 WP_000709517 hypothetical protein -
A6P37_RS29050 (A6P37_28715) 72689..73330 - 642 WP_000796664 hypothetical protein -
A6P37_RS29055 (A6P37_28720) 73624..73944 + 321 WP_000547566 hypothetical protein -
A6P37_RS29060 (A6P37_28725) 74248..74433 + 186 WP_001186917 hypothetical protein -
A6P37_RS29065 (A6P37_28730) 74653..75621 + 969 WP_000085162 AAA family ATPase -
A6P37_RS29070 (A6P37_28735) 75632..76540 + 909 WP_000739139 hypothetical protein -

Host bacterium

ID   1262 GenBank   NZ_CP015394
Plasmid name   CR14_p2 Incompatibility group   IncA/C2
Plasmid size   154343 bp Coordinate of oriT [Strand]   48342..48892 [+]
Host baterium   Klebsiella pneumoniae strain CR14

Cargo genes

Drug resistance gene   blaOXA-2, qacE, sul1, blaCTX-M-2, blaTEM-1B, aac(3)-IIa
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -