Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100801
Name   oriT_pMCB032-2 in_silico
Organism   Pandoraea pnomenusa strain MCB032
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP015373 (32660..33032 [-], 373 nt)
oriT length   373 nt
IRs (inverted repeats)      IR1: 64..68, 72..76  (GCGCC..GGCGC)
  IR2: 89..107, 110..128  (GTGAAGATAGATAACCGGC..GCCGGTTAGCTAACTTCAC)
Location of nic site      136..137
Conserved sequence flanking the
  nic site    		  CATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 373 nt

>oriT_pMCB032-2
GCCTCGCCTCGTCTCTCATGCCGGCGGTAGCCGGCTGCCTCGCAGAGCAGGATGACCCGTTGAGCGCCCCCGGCGCGAATAAGGGACAGTGAAGATAGATAACCGGCTCGCCGGTTAGCTAACTTCACACATCCTGCCCGCCTTACGGCGTTAATAACACCAAGGAAAGTCTACACCAGCCATTACGATTTATCCGCAACTATCGCGCTATCAGGCCGCAAAAGCAGCAACGGATATAGCGAAAACCGCCACAATGGCCCATAATGCCGCTATCGAAGCGTGCCAATGCACGCCGATAGCGGACTTTTTGCGTTTCCGTAGCGCCGCTTAGTAGCGTTACATTTGCGATGAGAGGATTAGATGGACGAACACG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   873 GenBank   WP_011114057
Name   TraI_pMCB032-2 insolico UniProt ID   A0A168KW18
Length   746 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 746 a.a.        Molecular weight: 82038.71 Da        Isoelectric Point: 10.7900

>WP_011114057.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Bacteria]
MIAKHVPMRSLGKSDFAGLANYITDAQSKDHRLGHVQATNCEAGSIQDAITEVLATQHTNTRAKGDKTYH
LIVSFRAGEQPSADTLRAIEERICVGLGYGEHQRISAVHNDTDNLHIHIAINKIHPTRHTMHEPYYPHRA
LAELCTALERDYGLERDNHEPRKRGAEGRAADMERHAGVESLVGWIKRECLDEIKGAQSWQELHQVMRDN
GMELRVRANGLVFEAGDGTMVKASTVARDLSKPSLEARLGPFEASPERQAQTTAKRQYRKDPIRLRVNTV
ELYAKYKAEQQSLTTARAQALERARHRKDRLIEAAKRSNRLRRATIKVVGEGRANKKLLYAQASKALRSE
LQAINKQFQQERTALYAEHSRRTWADWLKKEAQHGGADALAALRAREAAQGLKGNTIRGEGQAKPGHAPA
VDNITKKGTIIFRAGMSAVRDDGDRLQVSREATREGLQEALRLAMQRYGNRITVNGTVEFKAQMIRAAVD
SQLPITFTDPALESRRQALLNKENTHERTERPEHRGRTGRGAGGPGQRPAADQHATGAAAVARAGDGRPA
AGRGDRADAGLHAATVHRKPDVGRLGRKPPPQSQHRLRALSELGVVRIAGGSEVLLPRDVPRHVEQQGTQ
PDHALRRGISRPGTGVGQTPPGVAAADKYIAEREAKRLKGFDIPKHSRYTAGDGALTFQGTRTIEGQALA
LLKRGDEVMVMPIDQATARRLTRIAVGDAVSITAKGSIKTSKGRSR

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(422-508)

Relaxase/Mobilisation nuclease domain (Relaxase)

(12-251)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 50408..61084

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A6P55_RS25645 (A6P55_25655) 45548..46084 - 537 WP_037031213 hypothetical protein -
A6P55_RS25650 (A6P55_25660) 46098..46424 - 327 WP_009238012 type II toxin-antitoxin system PemK/MazF family toxin -
A6P55_RS25655 (A6P55_25665) 46421..46678 - 258 WP_009238013 antitoxin -
A6P55_RS25660 (A6P55_25670) 46860..47426 + 567 WP_063599763 recombinase family protein -
A6P55_RS25665 (A6P55_25675) 47714..48145 - 432 WP_001665065 OmpA family protein -
A6P55_RS25670 (A6P55_25680) 48161..48859 - 699 WP_011114053 TraX family protein -
A6P55_RS25675 (A6P55_25685) 48859..49125 - 267 WP_010890140 hypothetical protein -
A6P55_RS25680 (A6P55_25690) 49154..49789 - 636 WP_011114052 transglycosylase SLT domain-containing protein -
A6P55_RS25685 (A6P55_25695) 49803..50390 - 588 WP_010890138 TrbM/KikA/MpfK family conjugal transfer protein -
A6P55_RS25690 (A6P55_25700) 50408..52126 - 1719 WP_011114051 P-type conjugative transfer protein TrbL virB6
A6P55_RS25695 (A6P55_25705) 52137..52364 - 228 WP_000644148 entry exclusion lipoprotein TrbK -
A6P55_RS25700 (A6P55_25710) 52374..53138 - 765 WP_010890135 P-type conjugative transfer protein TrbJ virB5
A6P55_RS25705 (A6P55_25715) 53159..54580 - 1422 WP_011114050 TrbI/VirB10 family protein virB10
A6P55_RS25710 (A6P55_25720) 54585..55073 - 489 WP_006122479 conjugal transfer protein TrbH -
A6P55_RS25715 (A6P55_25725) 55076..55975 - 900 WP_006122480 P-type conjugative transfer protein TrbG virB9
A6P55_RS25720 (A6P55_25730) 55993..56775 - 783 WP_011114048 conjugal transfer protein TrbF virB8
A6P55_RS25725 (A6P55_25735) 56772..59330 - 2559 WP_011114047 VirB4 family type IV secretion/conjugal transfer ATPase virb4
A6P55_RS25730 (A6P55_25740) 59327..59638 - 312 WP_001207961 conjugal transfer protein TrbD virB3
A6P55_RS25735 (A6P55_25745) 59642..60105 - 464 Protein_64 conjugal transfer system pilin TrbC -
A6P55_RS25740 (A6P55_25750) 60122..61084 - 963 WP_000132020 P-type conjugative transfer ATPase TrbB virB11
A6P55_RS25745 (A6P55_25755) 61394..61756 - 363 WP_011114045 transcriptional regulator -
A6P55_RS25750 (A6P55_25760) 61870..62211 + 342 WP_000019167 single-stranded DNA-binding protein -
A6P55_RS25755 (A6P55_25765) 62258..63478 + 1221 WP_011114072 plasmid replication initiator TrfA -
A6P55_RS25760 (A6P55_25770) 63591..64025 - 435 WP_003131969 mercury resistance transcriptional regulator MerR -
A6P55_RS25765 (A6P55_25775) 64097..64447 + 351 WP_003131974 mercuric ion transporter MerT -
A6P55_RS25770 (A6P55_25780) 64460..64735 + 276 WP_003131987 mercury resistance system periplasmic binding protein MerP -

Host bacterium

ID   1261 GenBank   NZ_CP015373
Plasmid name   pMCB032-2 Incompatibility group   IncP1
Plasmid size   85291 bp Coordinate of oriT [Strand]   32660..33032 [-]
Host baterium   Pandoraea pnomenusa strain MCB032

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   merR, merT, merP, merA, merD, merE
Degradation gene   bphA1
Symbiosis gene   -
Anti-CRISPR   AcrIF24