Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100800
Name   oriT_p2011C-3911-1 in_silico
Organism   Escherichia coli strain 2011C-3911
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP015239 (92474..92752 [+], 279 nt)
oriT length   279 nt
IRs (inverted repeats)      220..227, 230..237  (GCAAAAAC..GTTTTTGC)
Location of nic site      246..247
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 279 nt

>oriT_p2011C-3911-1
CGCTAGCAGCGCCCCTGGCGGTATCCTATAAAAAAATACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGCTGTAGCGGCGTTAACAACGCCGCTTTAAATAAATCAGATTTAAACAATATAAATCCACAAATACAACTCAATGATATTAAACGCAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   872 GenBank   WP_032326999
Name   TraI_p2011C-3911-1 insolico UniProt ID   _
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191717.26 Da        Isoelectric Point: 5.9150

>WP_032326999.1 conjugative transfer relaxase/helicase TraI [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIEAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEIKMAEWMQT
LKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVIMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGHDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGEASLESAISHQKSALHTPAQQAIHLALPVVESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLHVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWVPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGTITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVRDIAGLERDRSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

DNA helicase TraI (TraI_C)

(1434-1557)

AAA domain (AAA_30)

(968-1156)

TrwC relaxase (TrwC)

(10-283)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 66111..93320

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A5956_RS00255 (A5956_24345) 61269..61667 + 399 WP_000911320 type II toxin-antitoxin system VapC family toxin -
A5956_RS00260 (A5956_24350) 61676..63878 - 2203 Protein_53 type IV conjugative transfer system coupling protein TraD -
A5956_RS00265 (A5956_24355) 63934..64665 - 732 WP_047643166 hypothetical protein -
A5956_RS00270 (A5956_24360) 64841..65629 - 789 WP_032327001 hypothetical protein -
A5956_RS00275 (A5956_24365) 65797..66108 + 312 WP_000522220 heavy metal-binding domain-containing protein -
A5956_RS00280 (A5956_24370) 66111..68930 - 2820 WP_032327002 conjugal transfer mating-pair stabilization protein TraG traG
A5956_RS00285 (A5956_24375) 68927..70300 - 1374 WP_000944332 conjugal transfer pilus assembly protein TraH traH
A5956_RS00290 (A5956_24380) 70287..70679 - 393 WP_032327004 F-type conjugal transfer protein TrbF -
A5956_RS00295 (A5956_24385) 70660..71007 - 348 WP_071532380 P-type conjugative transfer protein TrbJ -
A5956_RS00300 (A5956_24390) 70937..71517 - 581 Protein_61 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB -
A5956_RS00305 (A5956_24395) 71504..71794 - 291 WP_021521297 type-F conjugative transfer system pilin chaperone TraQ -
A5956_RS00310 (A5956_24400) 72190..72531 - 342 WP_000556797 conjugal transfer protein TrbA -
A5956_RS00315 (A5956_24405) 72545..73288 - 744 WP_001030373 type-F conjugative transfer system pilin assembly protein TraF traF
A5956_RS00320 (A5956_24410) 73281..73538 - 258 WP_000864346 conjugal transfer protein TrbE -
A5956_RS00325 (A5956_24415) 73552..75456 - 1905 WP_050437107 type-F conjugative transfer system mating-pair stabilization protein TraN traN
A5956_RS00330 (A5956_24420) 75550..75930 - 381 WP_000056344 hypothetical protein -
A5956_RS00335 (A5956_24425) 75927..76565 - 639 WP_001035178 type-F conjugative transfer system pilin assembly protein TrbC trbC
A5956_RS00340 (A5956_24430) 76758..76997 + 240 WP_001066128 hypothetical protein -
A5956_RS00345 (A5956_24435) 76994..77173 - 180 WP_000970212 hypothetical protein -
A5956_RS27030 77194..77318 - 125 Protein_71 TraU family protein -
A5956_RS00350 (A5956_24440) 77353..77799 - 447 WP_001289131 hypothetical protein -
A5956_RS00360 (A5956_24450) 78527..79069 - 543 WP_032327006 hypothetical protein -
A5956_RS00365 (A5956_24455) 79083..80075 - 993 WP_000817328 conjugal transfer pilus assembly protein TraU traU
A5956_RS00370 (A5956_24460) 80072..80704 - 633 WP_001203739 type-F conjugative transfer system protein TraW traW
A5956_RS00375 (A5956_24465) 80701..81087 - 387 WP_000214101 type-F conjugative transfer system protein TrbI -
A5956_RS00380 (A5956_24470) 81084..83714 - 2631 WP_032327007 type IV secretion system protein TraC virb4
A5956_RS27035 (A5956_24475) 83839..84186 - 348 WP_000836684 hypothetical protein -
A5956_RS27930 84214..84432 - 219 WP_071528664 hypothetical protein -
A5956_RS00390 (A5956_24480) 84512..84985 - 474 WP_032327008 hypothetical protein -
A5956_RS00395 (A5956_24485) 84996..85391 - 396 WP_000549593 hypothetical protein -
A5956_RS00400 (A5956_24490) 85384..85605 - 222 WP_001278977 conjugal transfer protein TraR -
A5956_RS00405 (A5956_24495) 85740..86255 - 516 WP_000809868 type IV conjugative transfer system lipoprotein TraV traV
A5956_RS00410 (A5956_24500) 86252..86503 - 252 WP_001038341 conjugal transfer protein TrbG -
A5956_RS00415 (A5956_24505) 86496..86816 - 321 WP_032327009 conjugal transfer protein TrbD virb4
A5956_RS00420 (A5956_24510) 86803..87390 - 588 WP_032327010 conjugal transfer pilus-stabilizing protein TraP -
A5956_RS00425 (A5956_24515) 87380..88810 - 1431 WP_000146622 F-type conjugal transfer pilus assembly protein TraB traB
A5956_RS00430 (A5956_24520) 88810..89538 - 729 WP_001365587 type-F conjugative transfer system secretin TraK traK
A5956_RS00435 (A5956_24525) 89525..90091 - 567 WP_000399759 type IV conjugative transfer system protein TraE traE
A5956_RS00440 (A5956_24530) 90113..90424 - 312 WP_000012099 type IV conjugative transfer system protein TraL traL
A5956_RS00445 (A5956_24535) 90439..90792 - 354 WP_028985883 type IV conjugative transfer system pilin TraA -
A5956_RS24835 90827..91054 - 228 WP_024180943 conjugal transfer relaxosome protein TraY -
A5956_RS00450 (A5956_24540) 91173..91820 - 648 WP_000332526 transcriptional regulator TraJ family protein -
A5956_RS00455 (A5956_24545) 92014..92397 - 384 WP_001151535 conjugal transfer relaxosome DNA-binding protein TraM -
A5956_RS00460 (A5956_24550) 92673..93320 + 648 WP_000602507 transglycosylase SLT domain-containing protein virB1
A5956_RS00465 (A5956_24555) 93616..94437 - 822 WP_001234499 DUF932 domain-containing protein -
A5956_RS00470 (A5956_24560) 94556..94843 - 288 WP_000107543 hypothetical protein -
A5956_RS00475 (A5956_24565) 95000..95302 - 303 WP_001272236 hypothetical protein -
A5956_RS27935 95602..95775 + 174 Protein_99 hypothetical protein -
A5956_RS00485 (A5956_24575) 96229..96357 - 129 WP_236922137 type I toxin-antitoxin system Hok family toxin -
A5956_RS27940 96296..96448 - 153 Protein_101 DUF5431 family protein -
A5956_RS00495 (A5956_24585) 96622..97384 - 763 Protein_102 plasmid SOS inhibition protein A -
A5956_RS00500 (A5956_24590) 97381..97815 - 435 WP_032327046 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   1260 GenBank   NZ_CP015239
Plasmid name   p2011C-3911-1 Incompatibility group   IncFIC
Plasmid size   125977 bp Coordinate of oriT [Strand]   92474..92752 [+]
Host baterium   Escherichia coli strain 2011C-3911

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -