Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100797
Name   oriT_pEC732_IMP14 in_silico
Organism   Escherichia coli strain Ecol_732
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP015139 (88649..89199 [-], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pEC732_IMP14
GAGCAGAGCTATGTGTGACAAGAAGTATAGAAATTACGAGGTAGCCATCATGGTCGATGTGAACCCTTTCGACAGGGTTATGAATGAATTGAAAAGTCGTGGCCGCAAGAACGCTCACATCCTGAGCATCCTCCAATTCGACTGGCCTGCATCGGAGGCCATCATCGAGAAGCTGAGCTGCTACATCACAGACGGGATTAAGGCTAATCAGGAGCCTGTGATTTACCCGATCATTGAAGAAGCTCTGCATCGCTACAGCCAGCTCGTGTTTCATGAGCAGAGAGAGAAATATGAAGACCCGGCCAGAATTGGGGCATTTCTGGAAACCCTGATCACCGAAACCTGCCGGGCGTTGGAAGTGCAAATTGTCGATAGTGGCGGTGATTCATGGTCTGTCGATTCAGGAGAGTCGTTCTCACTGTGGCTTTCTTCCCATCCAGGAGAACTATCCATTAACCCGCAGCCCCATGAGGATGAGACCTCTTTGCGTGGCTTGCTGTATGAGCTCATCACCTGTGAGAGCGTGAAAACTGTTTTAAGGAGAACCGACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   869 GenBank   WP_000130000
Name   Relaxase_pEC732_IMP14 insolico UniProt ID   _
Length   101 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 65922..91065

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A4X18_RS25320 (A4X18_25305) 61048..61956 - 909 WP_000739139 hypothetical protein -
A4X18_RS25325 (A4X18_25310) 61967..62935 - 969 WP_000085160 AAA family ATPase -
A4X18_RS25330 (A4X18_25315) 63155..63340 - 186 WP_001186917 hypothetical protein -
A4X18_RS25335 (A4X18_25320) 63644..63964 - 321 WP_000547566 hypothetical protein -
A4X18_RS25340 (A4X18_25325) 64259..64900 + 642 WP_000796664 hypothetical protein -
A4X18_RS25345 (A4X18_25330) 65023..65883 + 861 WP_000709517 hypothetical protein -
A4X18_RS25350 (A4X18_25335) 65922..68717 - 2796 WP_001256484 conjugal transfer mating pair stabilization protein TraN traN
A4X18_RS25355 (A4X18_25340) 68833..69837 - 1005 WP_005507569 TraU family protein traU
A4X18_RS25360 (A4X18_25345) 69837..70508 - 672 WP_000575345 EAL domain-containing protein -
A4X18_RS25365 (A4X18_25350) 70505..71770 - 1266 WP_001447719 TrbC family F-type conjugative pilus assembly protein traW
A4X18_RS25370 (A4X18_25355) 71733..72263 - 531 WP_001010740 S26 family signal peptidase -
A4X18_RS25375 (A4X18_25360) 72260..72577 - 318 WP_000351984 hypothetical protein -
A4X18_RS25380 (A4X18_25365) 72592..75039 - 2448 WP_000637384 type IV secretion system protein TraC virb4
A4X18_RS25385 (A4X18_25370) 75036..75743 - 708 WP_001259346 DsbC family protein -
A4X18_RS25390 (A4X18_25375) 75892..81378 - 5487 WP_000606835 Ig-like domain-containing protein -
A4X18_RS25395 (A4X18_25380) 81579..81971 - 393 WP_000479535 TraA family conjugative transfer protein -
A4X18_RS25400 (A4X18_25385) 81975..82553 - 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
A4X18_RS25405 (A4X18_25390) 82550..83863 - 1314 WP_024131605 TraB/VirB10 family protein traB
A4X18_RS25410 (A4X18_25395) 83863..84780 - 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
A4X18_RS25415 (A4X18_25400) 84764..85390 - 627 WP_001049717 TraE/TraK family type IV conjugative transfer system protein traE
A4X18_RS25420 (A4X18_25405) 85387..85668 - 282 WP_000805625 type IV conjugative transfer system protein TraL traL
A4X18_RS25425 (A4X18_25410) 85813..86178 - 366 WP_001052530 hypothetical protein -
A4X18_RS31515 86190..86333 - 144 WP_001275801 hypothetical protein -
A4X18_RS25430 (A4X18_25415) 86514..87176 - 663 WP_001231464 hypothetical protein -
A4X18_RS25435 (A4X18_25420) 87176..87553 - 378 WP_000869297 hypothetical protein -
A4X18_RS25440 (A4X18_25425) 87563..88009 - 447 WP_000122507 hypothetical protein -
A4X18_RS25445 (A4X18_25430) 88019..88648 - 630 WP_000743449 DUF4400 domain-containing protein tfc7
A4X18_RS25450 (A4X18_25435) 88605..89150 - 546 WP_000228720 hypothetical protein -
A4X18_RS25455 (A4X18_25440) 89200..91065 - 1866 WP_000178857 conjugative transfer system coupling protein TraD virb4
A4X18_RS25460 (A4X18_25445) 91062..94034 - 2973 WP_001326173 MobH family relaxase -
A4X18_RS25465 (A4X18_25450) 94202..94819 + 618 WP_001249395 hypothetical protein -
A4X18_RS25470 (A4X18_25455) 94801..95034 + 234 WP_001191890 hypothetical protein -


Host bacterium


ID   1257 GenBank   NZ_CP015139
Plasmid name   pEC732_IMP14 Incompatibility group   IncA/C2
Plasmid size   186826 bp Coordinate of oriT [Strand]   88649..89199 [-]
Host baterium   Escherichia coli strain Ecol_732

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   mercury resistance
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -