Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100796
Name   oriT_pEC745_OXA48 in_silico
Organism   Escherichia coli strain Ecol_745
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP015075 (53486..53591 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pEC745_OXA48
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   868 GenBank   WP_004187323
Name   PutativerelaxaseofpEC745_OXA48 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 23392..50690

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A4R38_RS24855 (A4R38_24860) 18459..19256 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -
A4R38_RS24860 (A4R38_24865) 19558..20469 - 912 WP_015586033 LysR family transcriptional regulator -
A4R38_RS24865 (A4R38_24870) 20772..21980 + 1209 WP_001206290 IS4-like element IS10A family transposase -
A4R38_RS24870 (A4R38_24875) 21995..22429 - 435 Protein_35 CPBP family intramembrane glutamate endopeptidase -
A4R38_RS24875 (A4R38_24880) 22542..22892 + 351 WP_124065455 DUF1496 domain-containing protein -
A4R38_RS24880 (A4R38_24885) 22997..23392 + 396 WP_004187436 lytic transglycosylase domain-containing protein -
A4R38_RS24885 (A4R38_24890) 23392..24699 + 1308 WP_015059988 hypothetical protein trbA
A4R38_RS24890 (A4R38_24895) 24710..25660 + 951 WP_004206886 DsbC family protein trbB
A4R38_RS24895 (A4R38_24900) 25673..27760 + 2088 WP_004206885 conjugal transfer protein TrbC -
A4R38_RS28660 27811..27906 - 96 WP_004206884 DinQ-like type I toxin DqlB -
A4R38_RS24900 (A4R38_24905) 29129..30184 - 1056 WP_015060006 plasmid replication initiator RepA -
A4R38_RS24905 (A4R38_24910) 30480..30722 - 243 WP_023893611 IncL/M type plasmid replication protein RepC -
A4R38_RS24910 (A4R38_24915) 30791..31444 - 654 WP_015060005 hypothetical protein -
A4R38_RS24915 (A4R38_24920) 31446..33641 - 2196 WP_015062834 DotA/TraY family protein traY
A4R38_RS24920 (A4R38_24925) 33634..34230 - 597 WP_015060003 hypothetical protein -
A4R38_RS24925 (A4R38_24930) 34227..35435 - 1209 WP_011091082 conjugal transfer protein TraW traW
A4R38_RS24930 (A4R38_24935) 35432..38482 - 3051 WP_004187482 hypothetical protein traU
A4R38_RS24935 (A4R38_24940) 38479..38973 - 495 WP_004187480 hypothetical protein -
A4R38_RS24940 (A4R38_24945) 39019..39408 - 390 WP_004187479 DUF6750 family protein traR
A4R38_RS24945 (A4R38_24950) 39425..39955 - 531 WP_004187478 conjugal transfer protein TraQ traQ
A4R38_RS24950 (A4R38_24955) 39979..40683 - 705 WP_015060002 conjugal transfer protein TraP traP
A4R38_RS24955 (A4R38_24960) 40695..42044 - 1350 WP_004187474 conjugal transfer protein TraO traO
A4R38_RS24960 (A4R38_24965) 42056..43207 - 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
A4R38_RS24965 (A4R38_24970) 43216..43929 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
A4R38_RS24970 (A4R38_24975) 43997..44407 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
A4R38_RS24975 (A4R38_24980) 44436..44591 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
A4R38_RS24980 (A4R38_24985) 44592..45104 - 513 WP_011091071 hypothetical protein traL
A4R38_RS28555 45070..48462 - 3393 WP_223216381 LPD7 domain-containing protein -
A4R38_RS24990 (A4R38_24995) 48487..48747 - 261 WP_004187310 IcmT/TraK family protein traK
A4R38_RS24995 (A4R38_25000) 48737..49900 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
A4R38_RS25000 (A4R38_25005) 49911..50690 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
A4R38_RS25005 (A4R38_25010) 50687..51187 - 501 WP_004187320 DotD/TraH family lipoprotein -
A4R38_RS25010 (A4R38_25015) 51201..53180 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
A4R38_RS28560 53167..53694 - 528 WP_172740549 plasmid mobilization protein MobA -
A4R38_RS25020 (A4R38_25025) 53729..54124 + 396 WP_019725163 hypothetical protein -
A4R38_RS25025 (A4R38_25030) 54626..55162 - 537 WP_004187332 hypothetical protein -
A4R38_RS25030 (A4R38_25035) 55295..55606 - 312 WP_004187333 hypothetical protein -

Host bacterium

ID   1256 GenBank   NZ_CP015075
Plasmid name   pEC745_OXA48 Incompatibility group   IncL/M
Plasmid size   63544 bp Coordinate of oriT [Strand]   53486..53591 [+]
Host baterium   Escherichia coli strain Ecol_745

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -