Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100795
Name   oriT_pEC745_OXA48 in_silico
Organism   Escherichia coli strain Ecol_743
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP015071 (28728..28832 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pEC745_OXA48
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   867 GenBank   WP_004206924
Name   PutativerelaxaseofpEC745_OXA48 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..25930

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A4R39_RS24495 (A4R39_24495) 1..951 + 951 WP_004206886 DsbC family protein trbB
A4R39_RS24500 (A4R39_24500) 964..3051 + 2088 WP_004206885 conjugal transfer protein TrbC -
A4R39_RS29480 3102..3197 - 96 WP_004206884 DinQ-like type I toxin DqlB -
A4R39_RS24505 (A4R39_24505) 4407..5477 - 1071 WP_236927548 plasmid replication initiator RepA -
A4R39_RS24510 (A4R39_24510) 5774..6004 - 231 WP_004187496 IncL/M type plasmid replication protein RepC -
A4R39_RS24515 (A4R39_24515) 6078..6731 - 654 WP_004206935 hypothetical protein -
A4R39_RS24520 (A4R39_24520) 6734..8914 - 2181 WP_004187492 DotA/TraY family protein traY
A4R39_RS24525 (A4R39_24525) 8907..9557 - 651 WP_004187488 hypothetical protein -
A4R39_RS24530 (A4R39_24530) 9554..10762 - 1209 WP_004187486 conjugal transfer protein TraW traW
A4R39_RS24535 (A4R39_24535) 10759..13809 - 3051 WP_011154474 conjugative transfer protein traU
A4R39_RS24540 (A4R39_24540) 13806..14300 - 495 WP_004187480 hypothetical protein -
A4R39_RS24545 (A4R39_24545) 14346..14735 - 390 WP_011154472 DUF6750 family protein traR
A4R39_RS24550 (A4R39_24550) 14752..15282 - 531 WP_004187478 conjugal transfer protein TraQ traQ
A4R39_RS24555 (A4R39_24555) 15306..16010 - 705 WP_004206933 conjugal transfer protein TraP traP
A4R39_RS24560 (A4R39_24560) 16022..17371 - 1350 WP_036970781 conjugal transfer protein TraO traO
A4R39_RS24565 (A4R39_24565) 17383..18534 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
A4R39_RS24570 (A4R39_24570) 18543..19256 - 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
A4R39_RS24575 (A4R39_24575) 19324..19734 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
A4R39_RS24580 (A4R39_24580) 19763..19918 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
A4R39_RS24585 (A4R39_24585) 19919..20431 - 513 WP_011091071 hypothetical protein traL
A4R39_RS29395 20397..23702 - 3306 WP_220381329 LPD7 domain-containing protein -
A4R39_RS24595 (A4R39_24595) 23727..23987 - 261 WP_004187310 IcmT/TraK family protein traK
A4R39_RS24600 (A4R39_24600) 23977..25140 - 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
A4R39_RS24605 (A4R39_24605) 25151..25930 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
A4R39_RS24610 (A4R39_24610) 25927..26427 - 501 WP_004206925 DotD/TraH family lipoprotein -
A4R39_RS24615 (A4R39_24615) 26441..28420 - 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
A4R39_RS24620 (A4R39_24620) 28407..28724 - 318 WP_004206923 plasmid mobilization protein MobA -
A4R39_RS24625 (A4R39_24625) 29000..29365 + 366 WP_015586046 hypothetical protein -
A4R39_RS24630 (A4R39_24630) 29866..30402 - 537 WP_036970776 hypothetical protein -
A4R39_RS24635 (A4R39_24635) 30535..30846 - 312 WP_004187333 hypothetical protein -

Host bacterium

ID   1255 GenBank   NZ_CP015071
Plasmid name   pEC745_OXA48 Incompatibility group   IncL/M
Plasmid size   69471 bp Coordinate of oriT [Strand]   28728..28832 [-]
Host baterium   Escherichia coli strain Ecol_743

Cargo genes

Drug resistance gene   aph(6)-Id, aph(3'')-Ib, aph(3')-VIb, blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -