Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100790
Name   oriT_pSTY1-1898 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP014972 (37338..37447 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GTAATTGTAATAGCGTC..GACGGTATTACAATTAC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pSTY1-1898
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   862 GenBank   WP_071921283
Name   NikB_pSTY1-1898 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103977.49 Da        Isoelectric Point: 7.1635

>WP_071921283.1 IncI1-type relaxase NikB [Salmonella enterica]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRNRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGLLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGELVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFERDPRMGFEPEGNDGQFNQVFAEMVAW
YNVTGFSEHGNYVITRPDVDQHREVSERGYRNYMDSNTYRDGTQPVQDSENRWEPPTPV

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 48383..86425

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AX01_RS26365 (AX01_23835) 44679..45314 - 636 WP_063320176 CPBP family intramembrane glutamic endopeptidase -
AX01_RS24520 (AX01_23845) 46099..48390 - 2292 WP_072279317 F-type conjugative transfer protein TrbC -
AX01_RS24525 (AX01_23850) 48383..49453 - 1071 WP_023225282 IncI1-type conjugal transfer protein TrbB trbB
AX01_RS24530 (AX01_23855) 49472..50680 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
AX01_RS24535 (AX01_23860) 50972..51124 + 153 WP_001303307 Hok/Gef family protein -
AX01_RS24540 (AX01_23865) 51196..51447 - 252 WP_001291965 hypothetical protein -
AX01_RS25925 52371..52547 - 177 WP_001054900 hypothetical protein -
AX01_RS24550 (AX01_23870) 52939..53148 + 210 WP_000062603 HEAT repeat domain-containing protein -
AX01_RS24555 (AX01_23875) 53220..53882 - 663 WP_000644794 plasmid IncI1-type surface exclusion protein ExcA -
AX01_RS24560 (AX01_23880) 53953..56121 - 2169 WP_000698368 DotA/TraY family protein traY
AX01_RS24565 (AX01_23885) 56218..56802 - 585 WP_001037985 IncI1-type conjugal transfer protein TraX -
AX01_RS24570 (AX01_23890) 56831..58033 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
AX01_RS24575 (AX01_25775) 58000..58614 - 615 WP_000337400 IncI1-type conjugal transfer protein TraV traV
AX01_RS24580 (AX01_23895) 58614..61658 - 3045 WP_063320177 IncI1-type conjugal transfer protein TraU traU
AX01_RS24585 (AX01_23900) 61748..62548 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
AX01_RS24590 (AX01_23905) 62532..62720 - 189 WP_001277255 putative conjugal transfer protein TraS -
AX01_RS24595 (AX01_23910) 62784..63188 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
AX01_RS24600 (AX01_23915) 63239..63766 - 528 WP_001055569 conjugal transfer protein TraQ traQ
AX01_RS24605 (AX01_23920) 63766..64470 - 705 WP_042012199 IncI1-type conjugal transfer protein TraP traP
AX01_RS24610 (AX01_23925) 64470..65759 - 1290 WP_001271991 conjugal transfer protein TraO traO
AX01_RS24615 (AX01_23930) 65762..66745 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
AX01_RS24620 (AX01_23935) 66756..67448 - 693 WP_001685183 DotI/IcmL family type IV secretion protein traM
AX01_RS24625 (AX01_23940) 67445..67792 - 348 WP_001055900 conjugal transfer protein traL
AX01_RS24630 (AX01_23945) 67810..71577 - 3768 WP_063320178 LPD7 domain-containing protein -
AX01_RS24635 (AX01_23950) 71667..72218 - 552 WP_000014584 phospholipase D family protein -
AX01_RS24640 (AX01_25780) 72233..72523 - 291 WP_001314267 hypothetical protein traK
AX01_RS24645 (AX01_23955) 72520..73668 - 1149 WP_063320179 plasmid transfer ATPase TraJ virB11
AX01_RS24650 (AX01_23960) 73665..74483 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
AX01_RS24655 (AX01_23965) 74480..74938 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
AX01_RS24660 (AX01_23970) 75333..75917 - 585 WP_000977522 histidine phosphatase family protein -
AX01_RS24665 (AX01_23975) 75977..77179 - 1203 WP_063320180 conjugal transfer protein TraF -
AX01_RS24670 (AX01_23980) 77265..78089 - 825 WP_022630873 conjugal transfer protein TraE traE
AX01_RS24675 (AX01_23985) 78240..79394 - 1155 WP_001139955 site-specific integrase -
AX01_RS26225 (AX01_25785) 79393..79746 + 354 WP_001393368 hypothetical protein -
AX01_RS25855 80382..80630 + 249 WP_001349157 hypothetical protein -
AX01_RS24700 (AX01_23990) 80627..81919 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
AX01_RS24705 (AX01_25805) 81919..82575 - 657 WP_069200671 prepilin peptidase -
AX01_RS24710 (AX01_23995) 82560..83120 - 561 WP_063320181 lytic transglycosylase domain-containing protein virB1
AX01_RS24715 (AX01_24000) 83130..83744 - 615 WP_063320182 type 4 pilus major pilin -
AX01_RS24720 (AX01_24005) 83762..84859 - 1098 WP_063320183 type II secretion system F family protein -
AX01_RS24725 (AX01_24010) 84872..86425 - 1554 WP_023166903 ATPase, T2SS/T4P/T4SS family virB11
AX01_RS24730 (AX01_24015) 86436..86888 - 453 WP_001247870 type IV pilus biogenesis protein PilP -
AX01_RS24735 (AX01_24020) 86875..88170 - 1296 WP_063320184 type 4b pilus protein PilO2 -
AX01_RS24740 (AX01_24025) 88163..89845 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
AX01_RS24745 (AX01_24030) 89859..90296 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
AX01_RS24750 (AX01_24035) 90296..91363 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1250 GenBank   NZ_CP014972
Plasmid name   pSTY1-1898 Incompatibility group   IncI1
Plasmid size   95780 bp Coordinate of oriT [Strand]   37338..37447 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -