Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100787 |
| Name | oriT_pSTY1-2010K-1587  |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2010K-1587 |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP014966 (66466..67016 [+], 551 nt) |
| oriT length | 551 nt |
| IRs (inverted repeats) | IR1: 62..70, 71..79 (AACCCTTTC..GACAGGGTT) IR2: 143..150, 154..161 (TGGCCTGC..GGAGGCCA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 551 nt
>oriT_pSTY1-2010K-1587
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 859 | GenBank | WP_001326173 |
| Name | TraI_pSTY1-2010K-1587 |
UniProt ID | A0A1B2TRI1 |
| Length | 990 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 990 a.a. Molecular weight: 109356.90 Da Isoelectric Point: 4.9395
>WP_001326173.1 MULTISPECIES: MobH family relaxase [Gammaproteobacteria]
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPFDA
FSASAETASTDATNSEIPDVAMPGKQEKQPKQDFVPQEQNSLQGDDFPMFGSSDEPPSWAIEPLPMLTDA
PEQTTPAPAMPPTDKPNLHEKDAKTLLVEMLAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVILY
PDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQDA
FELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQKAKGKDSQPQQKEKKVDVTSPVEEPQRQ
PVQEKQNVARLPKREVQPVAPEPKVEREKELGHVEVREREEPEVREFEPPKAKTNPKDINAEDFLPSGVT
PQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKKRQ
GKLYLEVNET
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPFDA
FSASAETASTDATNSEIPDVAMPGKQEKQPKQDFVPQEQNSLQGDDFPMFGSSDEPPSWAIEPLPMLTDA
PEQTTPAPAMPPTDKPNLHEKDAKTLLVEMLAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVILY
PDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQDA
FELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQKAKGKDSQPQQKEKKVDVTSPVEEPQRQ
PVQEKQNVARLPKREVQPVAPEPKVEREKELGHVEVREREEPEVREFEPPKAKTNPKDINAEDFLPSGVT
PQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKKRQ
GKLYLEVNET
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 64600..89743
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AX04_RS23600 (AX04_23610) | 60631..60864 | - | 234 | WP_001191890 | hypothetical protein | - |
| AX04_RS23605 (AX04_23615) | 60846..61463 | - | 618 | WP_001249395 | hypothetical protein | - |
| AX04_RS23610 (AX04_23620) | 61631..64603 | + | 2973 | WP_001326173 | MobH family relaxase | - |
| AX04_RS23615 (AX04_23625) | 64600..66465 | + | 1866 | WP_000178857 | conjugative transfer system coupling protein TraD | virb4 |
| AX04_RS23620 (AX04_23630) | 66476..67060 | + | 585 | WP_000332868 | hypothetical protein | - |
| AX04_RS23625 (AX04_23635) | 67017..67646 | + | 630 | WP_000743449 | DUF4400 domain-containing protein | tfc7 |
| AX04_RS23630 (AX04_23640) | 67656..68102 | + | 447 | WP_000122507 | hypothetical protein | - |
| AX04_RS23635 (AX04_23645) | 68112..68489 | + | 378 | WP_000869297 | hypothetical protein | - |
| AX04_RS23640 (AX04_23650) | 68489..69151 | + | 663 | WP_001231464 | hypothetical protein | - |
| AX04_RS23645 (AX04_23655) | 69475..69852 | + | 378 | WP_000509509 | hypothetical protein | - |
| AX04_RS23650 (AX04_23660) | 69997..70278 | + | 282 | WP_000805625 | type IV conjugative transfer system protein TraL | traL |
| AX04_RS23655 (AX04_23665) | 70275..70901 | + | 627 | WP_001049717 | TraE/TraK family type IV conjugative transfer system protein | traE |
| AX04_RS23660 (AX04_23670) | 70885..71802 | + | 918 | WP_000794249 | type-F conjugative transfer system secretin TraK | traK |
| AX04_RS23665 (AX04_23675) | 71799..73115 | + | 1317 | WP_000595749 | TraB/VirB10 family protein | traB |
| AX04_RS23670 (AX04_23680) | 73112..73690 | + | 579 | WP_000793435 | type IV conjugative transfer system lipoprotein TraV | traV |
| AX04_RS23675 (AX04_23685) | 73694..74086 | + | 393 | WP_000479535 | TraA family conjugative transfer protein | - |
| AX04_RS23680 (AX04_23690) | 74287..79773 | + | 5487 | WP_000606835 | Ig-like domain-containing protein | - |
| AX04_RS23685 (AX04_23695) | 79922..80629 | + | 708 | WP_001259346 | DsbC family protein | - |
| AX04_RS23690 (AX04_23700) | 80626..83073 | + | 2448 | WP_020833628 | type IV secretion system protein TraC | virb4 |
| AX04_RS23695 (AX04_23705) | 83088..83405 | + | 318 | WP_000351984 | hypothetical protein | - |
| AX04_RS23700 (AX04_23710) | 83402..83932 | + | 531 | WP_001010740 | S26 family signal peptidase | - |
| AX04_RS23705 (AX04_23715) | 83895..85160 | + | 1266 | WP_001447719 | TrbC family F-type conjugative pilus assembly protein | traW |
| AX04_RS23710 (AX04_23720) | 85157..85828 | + | 672 | WP_000575345 | EAL domain-containing protein | - |
| AX04_RS23715 (AX04_23725) | 85825..86832 | + | 1008 | WP_000983282 | TraU family protein | traU |
| AX04_RS23720 (AX04_23730) | 86936..89743 | + | 2808 | WP_077918294 | conjugal transfer mating pair stabilization protein TraN | traN |
| AX04_RS23725 (AX04_23735) | 89782..90642 | - | 861 | WP_020833630 | hypothetical protein | - |
| AX04_RS25840 | 90820..91119 | + | 300 | Protein_122 | MFS transporter | - |
| AX04_RS23730 (AX04_23740) | 91042..91683 | - | 642 | WP_000134999 | MBL fold metallo-hydrolase | - |
| AX04_RS23735 (AX04_23745) | 91923..93185 | - | 1263 | WP_000608644 | IS1380-like element ISEcp1 family transposase | - |
| AX04_RS23740 (AX04_23750) | 93338..94276 | - | 939 | WP_077950685 | hypothetical protein | - |
| AX04_RS25845 | 94427..94651 | + | 225 | WP_001331036 | hypothetical protein | - |
Region 2: 113562..153264
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AX04_RS23835 (AX04_23845) | 109408..109758 | - | 351 | WP_001405209 | IS66 family insertion sequence element accessory protein TnpB | - |
| AX04_RS23840 (AX04_23850) | 109755..110174 | - | 420 | WP_004018134 | transposase | - |
| AX04_RS23845 (AX04_23855) | 110253..111824 | + | 1572 | Protein_155 | PilN family type IVB pilus formation outer membrane protein | - |
| AX04_RS23850 (AX04_23860) | 111817..113112 | + | 1296 | WP_000752774 | type 4b pilus protein PilO2 | - |
| AX04_RS23855 (AX04_23865) | 113099..113551 | + | 453 | WP_001247336 | type IV pilus biogenesis protein PilP | - |
| AX04_RS23860 (AX04_23870) | 113562..115115 | + | 1554 | WP_000362202 | ATPase, T2SS/T4P/T4SS family | virB11 |
| AX04_RS23865 (AX04_23875) | 115128..116225 | + | 1098 | WP_001208805 | type II secretion system F family protein | - |
| AX04_RS23870 (AX04_23880) | 116243..116857 | + | 615 | WP_000959785 | type 4 pilus major pilin | - |
| AX04_RS23875 (AX04_23885) | 116867..117427 | + | 561 | WP_000014116 | lytic transglycosylase domain-containing protein | virB1 |
| AX04_RS25890 | 117412..118068 | + | 657 | WP_001193553 | prepilin peptidase | - |
| AX04_RS23880 (AX04_23890) | 118056..119360 | + | 1305 | WP_077950686 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| AX04_RS26395 | 119357..119604 | - | 248 | Protein_164 | hypothetical protein | - |
| AX04_RS23885 (AX04_23895) | 119753..119959 | + | 207 | WP_000008649 | hypothetical protein | - |
| AX04_RS23890 (AX04_23900) | 119984..120310 | - | 327 | WP_001213803 | hypothetical protein | - |
| AX04_RS23895 (AX04_23905) | 120294..121448 | + | 1155 | WP_001139958 | site-specific integrase | - |
| AX04_RS23900 (AX04_23910) | 121599..122423 | + | 825 | WP_001238927 | conjugal transfer protein TraE | traE |
| AX04_RS23905 (AX04_23915) | 122509..123711 | + | 1203 | WP_000976353 | conjugal transfer protein TraF | - |
| AX04_RS23910 (AX04_23920) | 123771..124355 | + | 585 | WP_000977517 | histidine phosphatase family protein | - |
| AX04_RS23915 (AX04_23925) | 124750..125208 | + | 459 | WP_001079808 | IncI1-type conjugal transfer lipoprotein TraH | - |
| AX04_RS23920 (AX04_23930) | 125205..126023 | + | 819 | WP_000646097 | IncI1-type conjugal transfer lipoprotein TraI | traI |
| AX04_RS23925 (AX04_23935) | 126020..127168 | + | 1149 | WP_001024972 | plasmid transfer ATPase TraJ | virB11 |
| AX04_RS25900 | 127165..127455 | + | 291 | WP_071931453 | conjugal transfer protein | traK |
| AX04_RS23930 (AX04_23940) | 127470..128021 | + | 552 | WP_000014584 | phospholipase D family protein | - |
| AX04_RS23935 (AX04_23945) | 128111..131878 | + | 3768 | WP_001141535 | LPD7 domain-containing protein | - |
| AX04_RS23940 (AX04_23950) | 131896..132243 | + | 348 | WP_001055900 | conjugal transfer protein | traL |
| AX04_RS23945 (AX04_23955) | 132240..132932 | + | 693 | WP_000138552 | DotI/IcmL family type IV secretion protein | traM |
| AX04_RS23950 (AX04_23960) | 132943..133926 | + | 984 | WP_001191878 | IncI1-type conjugal transfer protein TraN | traN |
| AX04_RS23955 (AX04_23965) | 133929..135218 | + | 1290 | WP_001271997 | conjugal transfer protein TraO | traO |
| AX04_RS23960 (AX04_23970) | 135218..135922 | + | 705 | WP_000801920 | IncI1-type conjugal transfer protein TraP | traP |
| AX04_RS23965 (AX04_23975) | 135922..136449 | + | 528 | WP_001055569 | conjugal transfer protein TraQ | traQ |
| AX04_RS23970 (AX04_23980) | 136500..136904 | + | 405 | WP_000086957 | IncI1-type conjugal transfer protein TraR | traR |
| AX04_RS23975 (AX04_23985) | 136968..137156 | + | 189 | WP_001277255 | putative conjugal transfer protein TraS | - |
| AX04_RS23980 (AX04_23990) | 137140..137940 | + | 801 | WP_001164788 | IncI1-type conjugal transfer protein TraT | traT |
| AX04_RS23985 (AX04_23995) | 138030..141074 | + | 3045 | WP_001024780 | IncI1-type conjugal transfer protein TraU | traU |
| AX04_RS25905 | 141074..141688 | + | 615 | WP_000337398 | IncI1-type conjugal transfer protein TraV | traV |
| AX04_RS23990 (AX04_24000) | 141655..142857 | + | 1203 | WP_001189160 | IncI1-type conjugal transfer protein TraW | traW |
| AX04_RS23995 (AX04_24005) | 142886..143470 | + | 585 | WP_001037987 | IncI1-type conjugal transfer protein TraX | - |
| AX04_RS24000 (AX04_24010) | 143567..145735 | + | 2169 | WP_000698368 | DotA/TraY family protein | traY |
| AX04_RS24005 (AX04_24015) | 145806..146468 | + | 663 | WP_000644794 | plasmid IncI1-type surface exclusion protein ExcA | - |
| AX04_RS24010 (AX04_24020) | 146540..146749 | - | 210 | WP_000062603 | HEAT repeat domain-containing protein | - |
| AX04_RS25910 | 147449..147661 | - | 213 | WP_001372830 | hypothetical protein | - |
| AX04_RS24015 (AX04_24025) | 148038..149060 | + | 1023 | WP_001572805 | IS21-like element IS100 family transposase | - |
| AX04_RS24020 (AX04_24030) | 149060..149839 | + | 780 | WP_001323403 | IS21-like element IS100kyp family helper ATPase IstB | - |
| AX04_RS24025 (AX04_24035) | 150200..150451 | + | 252 | WP_001291965 | hypothetical protein | - |
| AX04_RS24030 (AX04_24040) | 150523..150675 | - | 153 | WP_001303307 | Hok/Gef family protein | - |
| AX04_RS24035 (AX04_24045) | 150967..152175 | + | 1209 | WP_000121273 | IncI1-type conjugal transfer protein TrbA | trbA |
| AX04_RS24040 (AX04_24050) | 152194..153264 | + | 1071 | WP_000151575 | IncI1-type conjugal transfer protein TrbB | trbB |
| AX04_RS24045 (AX04_24055) | 153257..155548 | + | 2292 | WP_001289271 | F-type conjugative transfer protein TrbC | - |
Host bacterium
| ID | 1247 | GenBank | NZ_CP014966 |
| Plasmid name | pSTY1-2010K-1587 | Incompatibility group | IncA/C2 |
| Plasmid size | 208900 bp | Coordinate of oriT [Strand] | 66466..67016 [+] |
| Host baterium | Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2010K-1587 |
Cargo genes
| Drug resistance gene | resistance to cetylpyridinium; quaternary ammonium compound resistance |
| Virulence gene | - |
| Metal resistance gene | mercury resistance |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |