Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100785 |
| Name | oriT_pASP-a58 |
| Organism | Aeromonas veronii strain AVNIH1 |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP014775 (166398..166948 [+], 551 nt) |
| oriT length | 551 nt |
| IRs (inverted repeats) | IR1: 62..70, 71..79 (AACCCTTTC..GACAGGGTT) IR2: 143..150, 154..161 (TGGCCTGC..GGAGGCCA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 551 nt
>oriT_pASP-a58
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 857 | GenBank | WP_000130000 |
| Name | Relaxase_pASP-a58 |
UniProt ID | A0A160F0V5 |
| Length | 101 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 101 a.a. Molecular weight: 11477.11 Da Isoelectric Point: 7.5204
>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A160F0V5 |
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 164532..189675
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WM43_RS22590 (WM43_22585) | 160563..160796 | - | 234 | WP_001191890 | hypothetical protein | - |
| WM43_RS22595 (WM43_22590) | 160778..161395 | - | 618 | WP_001249395 | hypothetical protein | - |
| WM43_RS22600 (WM43_22595) | 161563..164535 | + | 2973 | WP_001326173 | MobH family relaxase | - |
| WM43_RS22605 (WM43_22600) | 164532..166397 | + | 1866 | WP_000178857 | conjugative transfer system coupling protein TraD | virb4 |
| WM43_RS22610 (WM43_22605) | 166447..166992 | + | 546 | WP_000228720 | hypothetical protein | - |
| WM43_RS22615 (WM43_22610) | 166949..167578 | + | 630 | WP_000743449 | DUF4400 domain-containing protein | tfc7 |
| WM43_RS22620 (WM43_22615) | 167588..168034 | + | 447 | WP_000122507 | hypothetical protein | - |
| WM43_RS22625 (WM43_22620) | 168044..168421 | + | 378 | WP_000869297 | hypothetical protein | - |
| WM43_RS22630 (WM43_22625) | 168421..169083 | + | 663 | WP_001231464 | hypothetical protein | - |
| WM43_RS22635 (WM43_22630) | 169419..169784 | + | 366 | WP_001052530 | hypothetical protein | - |
| WM43_RS22640 (WM43_22635) | 169929..170210 | + | 282 | WP_000805625 | type IV conjugative transfer system protein TraL | traL |
| WM43_RS22645 (WM43_22640) | 170207..170833 | + | 627 | WP_001049717 | TraE/TraK family type IV conjugative transfer system protein | traE |
| WM43_RS22650 (WM43_22645) | 170817..171734 | + | 918 | WP_000794249 | type-F conjugative transfer system secretin TraK | traK |
| WM43_RS22655 (WM43_22650) | 171734..173047 | + | 1314 | WP_024131605 | TraB/VirB10 family protein | traB |
| WM43_RS22660 (WM43_22655) | 173044..173622 | + | 579 | WP_000793435 | type IV conjugative transfer system lipoprotein TraV | traV |
| WM43_RS22665 (WM43_22660) | 173626..174018 | + | 393 | WP_000479535 | TraA family conjugative transfer protein | - |
| WM43_RS22670 (WM43_22665) | 174219..179705 | + | 5487 | WP_000606835 | Ig-like domain-containing protein | - |
| WM43_RS22675 (WM43_22670) | 179854..180561 | + | 708 | WP_001259346 | DsbC family protein | - |
| WM43_RS22680 (WM43_22675) | 180558..183005 | + | 2448 | WP_000637384 | type IV secretion system protein TraC | virb4 |
| WM43_RS22685 (WM43_22680) | 183020..183337 | + | 318 | WP_000351984 | hypothetical protein | - |
| WM43_RS22690 (WM43_22685) | 183334..183864 | + | 531 | WP_001010740 | S26 family signal peptidase | - |
| WM43_RS22695 (WM43_22690) | 183827..185092 | + | 1266 | WP_001447719 | TrbC family F-type conjugative pilus assembly protein | traW |
| WM43_RS22700 (WM43_22695) | 185089..185760 | + | 672 | WP_000575345 | EAL domain-containing protein | - |
| WM43_RS22705 (WM43_22700) | 185760..186764 | + | 1005 | WP_005507569 | TraU family protein | traU |
| WM43_RS22710 (WM43_22705) | 186880..189675 | + | 2796 | WP_001256484 | conjugal transfer mating pair stabilization protein TraN | traN |
| WM43_RS22715 (WM43_22710) | 189714..190574 | - | 861 | WP_000709517 | hypothetical protein | - |
| WM43_RS22720 (WM43_22715) | 190697..191338 | - | 642 | WP_000796664 | hypothetical protein | - |
| WM43_RS22725 (WM43_22720) | 191633..191953 | + | 321 | WP_000547566 | hypothetical protein | - |
| WM43_RS22730 (WM43_22725) | 192257..192442 | + | 186 | WP_001186917 | hypothetical protein | - |
| WM43_RS22735 (WM43_22730) | 192662..193630 | + | 969 | WP_000085160 | AAA family ATPase | - |
| WM43_RS22740 (WM43_22735) | 193641..194549 | + | 909 | WP_000739139 | hypothetical protein | - |
Host bacterium
| ID | 1245 | GenBank | NZ_CP014775 |
| Plasmid name | pASP-a58 | Incompatibility group | IncA/C2 |
| Plasmid size | 198307 bp | Coordinate of oriT [Strand] | 166398..166948 [+] |
| Host baterium | Aeromonas veronii strain AVNIH1 |
Cargo genes
| Drug resistance gene | quinolone resistance |
| Virulence gene | - |
| Metal resistance gene | mercury resistance |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |