Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100783
Name   oriT_pSAN1-2010K-2577 in_silico
Organism   Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1783
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP014662 (50510..50612 [-], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pSAN1-2010K-2577
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   855 GenBank   WP_001354015
Name   NikB_pSAN1-2010K-2577 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 55978..93744

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AW46_RS22930 (AW46_22930) 53694..55985 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
AW46_RS22935 (AW46_22935) 55978..57048 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
AW46_RS22940 (AW46_22940) 57067..58275 - 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
AW46_RS22945 (AW46_22945) 58567..58719 + 153 WP_001331364 Hok/Gef family protein -
AW46_RS26025 58791..58982 - 192 WP_174715448 hypothetical protein -
AW46_RS25985 59543..59638 + 96 WP_000609148 DinQ-like type I toxin DqlB -
AW46_RS25610 59703..59879 - 177 WP_001054904 hypothetical protein -
AW46_RS22955 (AW46_22955) 60271..60480 + 210 WP_000062603 HEAT repeat domain-containing protein -
AW46_RS22960 (AW46_22960) 60552..61214 - 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
AW46_RS22965 (AW46_22965) 61279..63441 - 2163 WP_000698351 DotA/TraY family protein traY
AW46_RS22970 (AW46_22970) 63538..64122 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
AW46_RS22975 (AW46_22975) 64151..65353 - 1203 WP_024261752 IncI1-type conjugal transfer protein TraW traW
AW46_RS24605 65320..65934 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
AW46_RS22980 (AW46_22980) 65934..68978 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
AW46_RS22985 (AW46_22985) 69068..69868 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
AW46_RS22990 (AW46_22990) 69852..70040 - 189 WP_001277255 putative conjugal transfer protein TraS -
AW46_RS22995 (AW46_22995) 70104..70508 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
AW46_RS23000 (AW46_23000) 70559..71086 - 528 WP_001055569 conjugal transfer protein TraQ traQ
AW46_RS23005 (AW46_23005) 71086..71790 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
AW46_RS23010 (AW46_23010) 71790..73079 - 1290 WP_001272005 conjugal transfer protein TraO traO
AW46_RS23015 (AW46_23015) 73082..74065 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
AW46_RS23020 (AW46_23020) 74076..74768 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
AW46_RS23025 (AW46_23025) 74765..75112 - 348 WP_001055900 conjugal transfer protein traL
AW46_RS23030 (AW46_23030) 75130..78897 - 3768 WP_001141529 LPD7 domain-containing protein -
AW46_RS23035 (AW46_23035) 78987..79538 - 552 WP_000014583 phospholipase D family protein -
AW46_RS24610 79553..79843 - 291 WP_001299214 hypothetical protein traK
AW46_RS23040 (AW46_23040) 79840..80988 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
AW46_RS23045 (AW46_23045) 80985..81803 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
AW46_RS23050 (AW46_23050) 81800..82258 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
AW46_RS23055 (AW46_23055) 82653..83237 - 585 WP_000977522 histidine phosphatase family protein -
AW46_RS23060 (AW46_23060) 83297..84499 - 1203 WP_000976351 conjugal transfer protein TraF -
AW46_RS23065 (AW46_23065) 84584..85408 - 825 WP_001238939 conjugal transfer protein TraE traE
AW46_RS23070 (AW46_23070) 85559..86713 - 1155 WP_001139957 site-specific integrase -
AW46_RS25940 86712..87065 + 354 WP_001393368 hypothetical protein -
AW46_RS25425 87701..87949 + 249 WP_001349157 hypothetical protein -
AW46_RS23075 (AW46_23075) 87946..89238 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
AW46_RS24645 89238..89894 - 657 WP_001193553 prepilin peptidase -
AW46_RS23080 (AW46_23080) 89879..90439 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
AW46_RS23085 (AW46_23085) 90449..91063 - 615 WP_000959785 type 4 pilus major pilin -
AW46_RS23090 (AW46_23090) 91081..92178 - 1098 WP_001208805 type II secretion system F family protein -
AW46_RS23095 (AW46_23095) 92191..93744 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
AW46_RS23100 (AW46_23100) 93755..94207 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
AW46_RS23105 (AW46_23105) 94194..95489 - 1296 WP_000752774 type 4b pilus protein PilO2 -
AW46_RS23110 (AW46_23110) 95482..97164 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
AW46_RS23115 (AW46_23115) 97178..97615 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
AW46_RS24650 97615..98682 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1243 GenBank   NZ_CP014662
Plasmid name   pSAN1-2010K-2577 Incompatibility group   IncI1
Plasmid size   103851 bp Coordinate of oriT [Strand]   50510..50612 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1783

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -