Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100782
Name   oriT_pSAN1-1727 in_silico
Organism   Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1727 isolate SAN1261-1
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP014622 (33979..34088 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pSAN1-1727
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   854 GenBank   WP_064757406
Name   NikB_pSAN1-1727 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104135.55 Da        Isoelectric Point: 7.2529

>WP_064757406.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLYLIAPVLFERDPRMGFEPEGNDGQFNQVFAEMVAW
HNVTGFSEHGNYVITRPDVDQHREVSERGYRNYMDSNTYRDGTQPVQDSENRWEPPTPV

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 45025..86638

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AW49_RS26805 (AW49_24215) 41320..41955 - 636 WP_000999379 CPBP family intramembrane glutamic endopeptidase -
AW49_RS25445 (AW49_24225) 42741..45032 - 2292 WP_001289267 F-type conjugative transfer protein TrbC -
AW49_RS25450 (AW49_24230) 45025..46095 - 1071 WP_000151573 IncI1-type conjugal transfer protein TrbB trbB
AW49_RS25455 (AW49_24235) 46114..47322 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
AW49_RS26810 (AW49_26035) 47614..47682 + 69 Protein_56 protein pndA -
AW49_RS25465 (AW49_24240) 47731..48957 - 1227 WP_001805100 RNA-guided endonuclease TnpB family protein -
AW49_RS25470 (AW49_24245) 49016..49420 + 405 WP_001175010 IS200/IS605 family transposase -
AW49_RS26170 49492..49584 + 93 Protein_59 Hok/Gef family protein -
AW49_RS25475 (AW49_24250) 49656..49907 - 252 WP_001291965 hypothetical protein -
AW49_RS26815 51025..51123 + 99 WP_022630883 DinQ-like type I toxin DqlB -
AW49_RS26420 51185..51361 - 177 WP_201259076 hypothetical protein -
AW49_RS25485 (AW49_24255) 51570..51779 - 210 WP_001140543 hemolysin expression modulator Hha -
AW49_RS25490 (AW49_24260) 51877..52491 - 615 WP_000578649 plasmid IncI1-type surface exclusion protein ExcA -
AW49_RS25495 (AW49_24265) 52567..54735 - 2169 WP_000698355 IncI1-type conjugal transfer membrane protein TraY traY
AW49_RS25500 (AW49_24270) 54832..55416 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
AW49_RS25505 (AW49_24275) 55445..56647 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
AW49_RS25510 (AW49_26050) 56614..57228 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
AW49_RS25515 (AW49_24280) 57228..60272 - 3045 WP_042966216 IncI1-type conjugal transfer protein TraU traU
AW49_RS25520 (AW49_24285) 60362..61162 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
AW49_RS25525 (AW49_24290) 61146..61334 - 189 WP_001277255 putative conjugal transfer protein TraS -
AW49_RS25530 (AW49_24295) 61398..61802 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
AW49_RS25535 (AW49_24300) 61853..62380 - 528 WP_001055569 conjugal transfer protein TraQ traQ
AW49_RS25540 (AW49_24305) 62380..63084 - 705 WP_042966215 IncI1-type conjugal transfer protein TraP traP
AW49_RS25545 (AW49_24310) 63084..64373 - 1290 WP_063267851 conjugal transfer protein TraO traO
AW49_RS25550 (AW49_24315) 64376..65359 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
AW49_RS25555 (AW49_24320) 65370..66062 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
AW49_RS25560 (AW49_24325) 66059..66406 - 348 WP_001055900 conjugal transfer protein traL
AW49_RS25565 (AW49_24330) 66424..70191 - 3768 WP_063267852 LPD7 domain-containing protein -
AW49_RS25570 (AW49_24335) 70281..70832 - 552 WP_000014584 phospholipase D family protein -
AW49_RS25575 (AW49_26055) 70847..71137 - 291 WP_001299214 hypothetical protein traK
AW49_RS25580 (AW49_24340) 71134..72282 - 1149 WP_001024974 plasmid transfer ATPase TraJ virB11
AW49_RS25585 (AW49_24345) 72279..73097 - 819 WP_000646095 IncI1-type conjugal transfer lipoprotein TraI traI
AW49_RS25590 (AW49_24350) 73094..73552 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
AW49_RS25595 (AW49_24355) 73947..74531 - 585 WP_000977522 histidine phosphatase family protein -
AW49_RS25600 (AW49_24360) 74591..75793 - 1203 WP_000976353 conjugal transfer protein TraF -
AW49_RS25605 (AW49_24365) 75879..76703 - 825 WP_001545755 conjugal transfer protein TraE traE
AW49_RS25610 (AW49_24370) 76854..77399 - 546 Protein_88 tyrosine-type recombinase/integrase -
AW49_RS25615 (AW49_24375) 77433..78401 + 969 WP_012904651 IS5 family transposase -
AW49_RS25620 (AW49_24380) 78457..79074 - 618 Protein_90 site-specific integrase -
AW49_RS26820 (AW49_26085) 80487..80711 + 225 Protein_91 hypothetical protein -
AW49_RS25655 (AW49_24385) 80708..82132 - 1425 WP_063267855 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
AW49_RS25660 (AW49_26090) 82132..82788 - 657 WP_001193553 prepilin peptidase -
AW49_RS25665 (AW49_24390) 82773..83333 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
AW49_RS25670 (AW49_24395) 83343..83957 - 615 WP_001542527 type 4 pilus major pilin -
AW49_RS25675 (AW49_24400) 83975..85072 - 1098 WP_001492931 type II secretion system F family protein -
AW49_RS25680 (AW49_24405) 85085..86638 - 1554 WP_001492932 ATPase, T2SS/T4P/T4SS family virB11
AW49_RS25685 (AW49_24410) 86649..87101 - 453 WP_001247870 type IV pilus biogenesis protein PilP -
AW49_RS25690 (AW49_24415) 87088..88383 - 1296 WP_000752775 type 4b pilus protein PilO2 -
AW49_RS25695 (AW49_24420) 88376..90058 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
AW49_RS25700 (AW49_24425) 90072..90509 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
AW49_RS25705 (AW49_26095) 90509..91576 - 1068 WP_071892277 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1242 GenBank   NZ_CP014622
Plasmid name   pSAN1-1727 Incompatibility group   IncI1
Plasmid size   97041 bp Coordinate of oriT [Strand]   33979..34088 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1727 isolate SAN1261-1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -