Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100773
Name   oriT_pFB7 in_silico
Organism   Xylella fastidiosa strain Fb7
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP014330 (29581..29683 [+], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      53..70, 75..92  (GTGAAGAAGGAACACCGG..CCGGTGGGCCTACTTCAC)
Location of nic site      100..101
Conserved sequence flanking the
  nic site    		  TATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pFB7
AGCCTCGCAGAGCAGGATTCCCGTTGAGTGCCGAAGGTACGAATAAGGGAAAGTGAAGAAGGAACACCGGATTTCCGGTGGGCCTACTTCACATATCCTGCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   845 GenBank   WP_088371470
Name   TraI_pFB7 insolico UniProt ID   _
Length   830 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 830 a.a.        Molecular weight: 92694.63 Da        Isoelectric Point: 10.5626

>WP_088371470.1 TraI/MobA(P) family conjugative relaxase [Xylella fastidiosa]
MIAKHVPMRVVKKSDFRELVKYLSNQQGKQERVGCVTVTNCFQNNVLDAALEVQATQALNTRSEADKTYH
LLISFREGENPAPEILEVIESRVCAALGYADYQRVSVVHHDTDNLHIHVAINKIHPKRYTIHTPYNDYKT
LGEICKKLEREYGLEADNHTVRKTVGENRADDMERHAGVESLLGWIKRECTDQIKQAQSWSELYAVMQRN
GLEIRERGNGLVITNGVGQSVKASSVARDFSKAKLEARFGAFESFVKQAPSVSSVHARRIQAPLVEKVGR
RPPPRSKGRTPSLSSVGVLHVNSGIRYEQRPIYVKQANTAELYAMYKLEQQDLGAVRNVAIARARTKRDR
KIEATKRLGRIKRAAIKLMRGPGVNKKLLYALARKSLKEGVQKANTDYLKARDAAYATYHRRVWADWLQV
QATQGNAEALAALRAREMRQWWSCNIFGGLQARRTGPVPGLKPDNITKAGTVIYRVGSTAIRDDGDLLNV
SHGAGDYGVEAALRMAMYRYGERITVKGSDEFKKRVVQIAAAARLNISFDDEVLDKRRKQLVSDAAVIVK
LTDAMLSDKTAQFTQAQASRVGAFQEDALSEYDAAISRSINLANQEQINEQQRTRAKHYFVQRWSDRGGP
NSRRDGHATRIRSGGGGSGKHGASGATVISSAGGFNKPNVGGIGAKPPPASTHRLRNLHQLGVVQFSRGS
EVLLPRHVSDCVGEQQTERNHRVRRDVHTAGITSSELMAVDKYIAERELKRVTMFDIMKHRRYNEDDAGM
VKFAGLRQVDGKSLVLLKRNDEVIVLAIDVATARRMKRFSLGDEVLLTNKGTLKTKGRNR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(12-250)

Large polyvalent protein-associated domain 7 (LPD7)

(463-550)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 22682..32863

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XFFB_RS13040 (XFFB_012180) 18140..18904 - 765 WP_088371486 ParA family protein -
XFFB_RS13045 (XFFB_012185) 18901..19206 - 306 WP_088372195 transcriptional regulator KorA -
XFFB_RS13050 (XFFB_012190) 19402..19722 - 321 WP_088371488 KleE stable inheritance protein -
XFFB_RS13055 (XFFB_012195) 20308..21219 - 912 WP_088371490 replication protein RepA -
XFFB_RS13060 (XFFB_012200) 21263..21610 - 348 WP_088371491 hypothetical protein -
XFFB_RS13065 (XFFB_012205) 21654..22013 - 360 WP_004091494 single-stranded DNA-binding protein -
XFFB_RS13070 (XFFB_012210) 22130..22486 + 357 WP_088371493 transcriptional regulator -
XFFB_RS13075 (XFFB_012215) 22682..23644 + 963 WP_088372298 P-type conjugative transfer ATPase TrbB virB11
XFFB_RS13080 (XFFB_012220) 23657..24049 + 393 WP_042463304 TrbC/VirB2 family protein virB2
XFFB_RS13085 (XFFB_012225) 24052..24372 + 321 WP_088371495 conjugal transfer protein TrbD virB3
XFFB_RS13090 (XFFB_012230) 24360..26924 + 2565 WP_088371497 conjugal transfer protein TrbE virb4
XFFB_RS13095 (XFFB_012235) 26921..27637 + 717 WP_010895237 conjugal transfer protein TrbF virB8
XFFB_RS13100 (XFFB_012240) 27654..28544 + 891 WP_010895236 P-type conjugative transfer protein TrbG virB9
XFFB_RS13105 (XFFB_012245) 28547..29023 + 477 WP_010895235 conjugal transfer protein TrbH -
XFFB_RS13110 (XFFB_012250) 29029..30432 + 1404 WP_042464052 TrbI/VirB10 family protein virB10
XFFB_RS13115 (XFFB_012255) 30451..31224 + 774 WP_042464049 P-type conjugative transfer protein TrbJ virB5
XFFB_RS13120 (XFFB_012260) 31241..31477 + 237 WP_010894503 EexN family lipoprotein -
XFFB_RS13125 (XFFB_012265) 31499..32863 + 1365 WP_088371499 P-type conjugative transfer protein TrbL virB6
XFFB_RS13130 (XFFB_012270) 32869..33468 + 600 WP_010895232 conjugal transfer protein TrbN -
XFFB_RS13135 (XFFB_012275) 33623..33958 - 336 WP_023908247 helix-turn-helix transcriptional regulator -
XFFB_RS13140 (XFFB_012280) 33939..34325 - 387 WP_088371501 type II toxin-antitoxin system RelE/ParE family toxin -
XFFB_RS13145 (XFFB_012285) 34442..34599 + 158 Protein_38 recombinase family protein -
XFFB_RS13150 (XFFB_012290) 34728..35483 + 756 WP_010895228 alpha/beta hydrolase -
XFFB_RS13155 (XFFB_012295) 35733..35963 + 231 WP_042464041 hypothetical protein -
XFFB_RS13160 (XFFB_012300) 35950..36276 + 327 WP_010895223 type II toxin-antitoxin system PemK/MazF family toxin -
XFFB_RS13165 (XFFB_012305) 36341..36613 + 273 WP_010895222 DUF4190 domain-containing protein -
XFFB_RS13170 (XFFB_012310) 37087..37572 - 486 WP_010895221 GNAT family N-acetyltransferase -
XFFB_RS13175 (XFFB_012315) 37569..37841 - 273 WP_010895220 DUF1778 domain-containing protein -

Host bacterium

ID   1233 GenBank   NZ_CP014330
Plasmid name   pFB7 Incompatibility group   _
Plasmid size   39408 bp Coordinate of oriT [Strand]   29581..29683 [+]
Host baterium   Xylella fastidiosa strain Fb7

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -