Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100768
Name   oriT_pKP38731-2 in_silico
Organism   Klebsiella pneumoniae strain KP38731
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP014298 (31515..31620 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKP38731-2
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   840 GenBank   WP_050868819
Name   MobA_pKP38731-2 insolico UniProt ID   A0A142BMF1
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75234.98 Da        Isoelectric Point: 10.0285

>WP_050868819.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPVYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSERDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A142BMF1


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 34416..50695

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AXK16_RS29370 29501..29811 + 311 Protein_48 hypothetical protein -
AXK16_RS29375 (AXK16_29455) 29944..30480 + 537 WP_011091066 hypothetical protein -
AXK16_RS29380 (AXK16_29460) 30981..31346 - 366 WP_011091067 hypothetical protein -
AXK16_RS29385 (AXK16_29465) 31622..31939 + 318 WP_011091068 plasmid mobilization protein MobA -
AXK16_RS29390 (AXK16_29470) 31926..33905 + 1980 WP_050868819 TraI/MobA(P) family conjugative relaxase -
AXK16_RS29395 (AXK16_29475) 33919..34419 + 501 WP_004187320 DotD/TraH family lipoprotein -
AXK16_RS29400 (AXK16_29480) 34416..35195 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
AXK16_RS29405 (AXK16_29485) 35206..36369 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
AXK16_RS29410 (AXK16_29490) 36359..36619 + 261 WP_004187310 IcmT/TraK family protein traK
AXK16_RS29415 (AXK16_29495) 38180..39855 + 1676 Protein_57 hypothetical protein -
AXK16_RS29420 39821..40333 + 513 WP_011091071 hypothetical protein traL
AXK16_RS29425 40334..40531 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
AXK16_RS29430 (AXK16_29500) 40518..40928 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AXK16_RS29435 (AXK16_29505) 40927..41709 + 783 WP_011091073 DotI/IcmL family type IV secretion protein traM
AXK16_RS29440 41718..42665 + 948 WP_148663877 DotH/IcmK family type IV secretion protein traN
AXK16_RS30685 (AXK16_29515) 42596..42868 + 273 WP_148663878 DotH/IcmK family type IV secretion protein traN
AXK16_RS29445 (AXK16_29520) 42880..44229 + 1350 WP_011091075 conjugal transfer protein TraO traO
AXK16_RS29450 (AXK16_29525) 44241..44944 + 704 Protein_65 conjugal transfer protein TraP -
AXK16_RS29455 (AXK16_29530) 44968..45498 + 531 WP_011091077 conjugal transfer protein TraQ traQ
AXK16_RS29460 (AXK16_29535) 45515..45904 + 390 WP_011091078 DUF6750 family protein traR
AXK16_RS29465 (AXK16_29540) 45950..46444 + 495 WP_011091080 hypothetical protein -
AXK16_RS29470 (AXK16_29545) 46441..49490 + 3050 Protein_69 conjugal transfer protein -
AXK16_RS29475 (AXK16_29550) 49487..50695 + 1209 WP_011091082 conjugal transfer protein TraW traW
AXK16_RS29480 (AXK16_29555) 50692..51342 + 651 WP_011091083 hypothetical protein -
AXK16_RS29485 (AXK16_29560) 51335..53514 + 2180 Protein_72 DotA/TraY family protein -
AXK16_RS29490 (AXK16_29565) 53517..54169 + 653 Protein_73 ExcA -


Host bacterium


ID   1228 GenBank   NZ_CP014298
Plasmid name   pKP38731-2 Incompatibility group   IncL/M
Plasmid size   70438 bp Coordinate of oriT [Strand]   31515..31620 [+]
Host baterium   Klebsiella pneumoniae strain KP38731

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -