Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100766
Name   oriT_F128-(C3026) in_silico
Organism   Escherichia coli K-12 strain K-12 C3026
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP014273 (118720..119009 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_F128-(C3026)
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAACGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACACTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   838 GenBank   WP_000987005
Name   TraI_F128-(C3026) insolico UniProt ID   _
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 192015.91 Da        Isoelectric Point: 5.8951

>WP_000987005.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEIKMAEWMQT
LKETGFDIRAYRDAADQRADLRTLTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNMKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGLPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVSDSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KTRAGETSLETAISHQKSALHTPAQQAIHLALPVVESKKLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVMPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDVREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTREIRPGQEQAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRAAITEREAALPEGVLREPQRVREAVREIARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

TrwC relaxase (TrwC)

(10-283)

DNA helicase TraI (TraI_C)

(1434-1557)

AAA domain (AAA_30)

(969-1156)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-625)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 118158..144559

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C3026_RS24415 (C3026_24415) 114154..114588 + 435 WP_000845928 conjugation system SOS inhibitor PsiB -
C3026_RS24420 (C3026_24420) 114585..115347 + 763 Protein_120 plasmid SOS inhibition protein A -
C3026_RS28950 115521..115670 + 150 Protein_121 DUF5431 family protein -
C3026_RS24430 (C3026_24430) 115612..115737 + 126 WP_096937776 type I toxin-antitoxin system Hok family toxin -
C3026_RS28630 (C3026_24435) 116038..116334 - 297 Protein_123 hypothetical protein -
C3026_RS28635 (C3026_24440) 116404..116610 + 207 WP_000547965 hypothetical protein -
C3026_RS24445 (C3026_24445) 116635..116922 + 288 WP_000107542 hypothetical protein -
C3026_RS24450 (C3026_24450) 117041..117862 + 822 WP_001234417 DUF932 domain-containing protein -
C3026_RS24455 (C3026_24455) 118158..118760 - 603 WP_077763528 transglycosylase SLT domain-containing protein virB1
C3026_RS24460 (C3026_24460) 119081..119464 + 384 WP_001151527 conjugal transfer relaxosome DNA-binding protein TraM -
C3026_RS24465 (C3026_24465) 119651..120340 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
C3026_RS24470 (C3026_24470) 120439..120834 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
C3026_RS24475 (C3026_24475) 120867..121232 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
C3026_RS24480 (C3026_24480) 121247..121558 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
C3026_RS24485 (C3026_24485) 121580..122146 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
C3026_RS24490 (C3026_24490) 122133..122861 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
C3026_RS24495 (C3026_24495) 122861..124288 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
C3026_RS24500 (C3026_24500) 124278..124868 + 591 WP_000002792 conjugal transfer pilus-stabilizing protein TraP -
C3026_RS24505 (C3026_24505) 124855..125052 + 198 WP_001443030 conjugal transfer protein TrbD -
C3026_RS24510 (C3026_24510) 125064..125315 + 252 WP_001038342 conjugal transfer protein TrbG -
C3026_RS24515 (C3026_24515) 125312..125827 + 516 WP_010892541 type IV conjugative transfer system lipoprotein TraV traV
C3026_RS27040 125962..126183 + 222 WP_001278689 conjugal transfer protein TraR -
C3026_RS24520 (C3026_24520) 126343..128970 + 2628 WP_001064243 type IV secretion system protein TraC virb4
C3026_RS24525 (C3026_24525) 128967..129353 + 387 WP_000099690 type-F conjugative transfer system protein TrbI -
C3026_RS24530 (C3026_24530) 129350..129982 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
C3026_RS24535 (C3026_24535) 129979..130971 + 993 WP_000830185 conjugal transfer pilus assembly protein TraU traU
C3026_RS24540 (C3026_24540) 130980..131618 + 639 WP_000777688 type-F conjugative transfer system pilin assembly protein TrbC trbC
C3026_RS24545 (C3026_24545) 131615..133423 + 1809 WP_000821835 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C3026_RS24550 (C3026_24550) 133450..133707 + 258 WP_000864318 conjugal transfer protein TrbE -
C3026_RS24555 (C3026_24555) 133700..134443 + 744 WP_001030367 type-F conjugative transfer system pilin assembly protein TraF traF
C3026_RS24560 (C3026_24560) 134459..134806 + 348 WP_001287913 conjugal transfer protein TrbA -
C3026_RS24565 (C3026_24565) 134808..135122 - 315 WP_000415566 protein ArtA -
C3026_RS24570 (C3026_24570) 135203..135487 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
C3026_RS24575 (C3026_24575) 135474..136019 + 546 WP_000059850 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C3026_RS24580 (C3026_24580) 135949..136290 + 342 WP_001443031 P-type conjugative transfer protein TrbJ -
C3026_RS24585 (C3026_24585) 136277..136657 + 381 WP_001366201 F-type conjugal transfer protein TrbF -
C3026_RS24590 (C3026_24590) 136657..138030 + 1374 WP_021553026 conjugal transfer pilus assembly protein TraH traH
C3026_RS24595 (C3026_24595) 138027..140843 + 2817 WP_001007055 conjugal transfer mating-pair stabilization protein TraG traG
C3026_RS27045 140876..141397 + 522 WP_000632670 conjugal transfer entry exclusion protein TraS -
C3026_RS24605 (C3026_24605) 141422..142153 + 732 WP_000850422 conjugal transfer complement resistance protein TraT -
C3026_RS24610 (C3026_24610) 142406..144559 + 2154 WP_000009350 type IV conjugative transfer system coupling protein TraD virb4
C3026_RS24615 (C3026_24615) 144568..144966 - 399 WP_000911324 type II toxin-antitoxin system VapC family toxin -
C3026_RS24620 (C3026_24620) 144966..145193 - 228 WP_000450532 toxin-antitoxin system antitoxin VapB -

Host bacterium

ID   1226 GenBank   NZ_CP014273
Plasmid name   F128-(C3026) Incompatibility group   IncFIC
Plasmid size   213924 bp Coordinate of oriT [Strand]   118720..119009 [-]
Host baterium   Escherichia coli K-12 strain K-12 C3026

Cargo genes

Drug resistance gene   -
Virulence gene   yagV/ecpE, yagW/ecpD, yagX/ecpC, yagY/ecpB, yagZ/ecpA, ykgK/ecpR
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -