Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100760 |
| Name | oriT_puk_P46212  |
| Organism | Escherichia coli strain uk_P46212 |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP013657 (73215..73664 [-], 450 nt) |
| oriT length | 450 nt |
| IRs (inverted repeats) | IR1: 201..215, 222..236 (ATTCATTGGTGAATC..GATTCACCAATGAAT) IR2: 308..315, 318..325 (GCAAAAAC..GTTTTTGC) |
| Location of nic site | 334..335 |
| Conserved sequence flanking the nic site |
GTGGGGTGT|GG |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 450 nt
>oriT_puk_P46212
ATATGTATACCTCTTTATTTTCTTATCGCATCAAATTTATTTCACATATAAAAAAATGACAATTCATCGATGAATCGAATCGTGACGCAAGTTACGAAAATTACGATTCATGCAGCAAATCACATCACGAATTGAATCTAGAGTCAATTCGCTTTAACTCGTTGTTTTATTATTACTGATTCATCTATGAGTTGCGTTAAATTCATTGGTGAATCATATGCGATTCACCAATGAATCCTTTTTATAATGTAAAATAAATTAAAATACATTATTTAAAACATAAGTTAATGATTCAAATAGCAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCCATCT
ATATGTATACCTCTTTATTTTCTTATCGCATCAAATTTATTTCACATATAAAAAAATGACAATTCATCGATGAATCGAATCGTGACGCAAGTTACGAAAATTACGATTCATGCAGCAAATCACATCACGAATTGAATCTAGAGTCAATTCGCTTTAACTCGTTGTTTTATTATTACTGATTCATCTATGAGTTGCGTTAAATTCATTGGTGAATCATATGCGATTCACCAATGAATCCTTTTTATAATGTAAAATAAATTAAAATACATTATTTAAAACATAAGTTAATGATTCAAATAGCAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCCATCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 832 | GenBank | WP_000130000 |
| Name | Relaxase_puk_P46212 |
UniProt ID | _ |
| Length | 101 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 101 a.a. Molecular weight: 11477.11 Da Isoelectric Point: 7.5204
>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 72730..105885
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUO99_RS00410 (AUO99_00410) | 68698..69132 | + | 435 | WP_000845901 | conjugation system SOS inhibitor PsiB | - |
| AUO99_RS00415 (AUO99_00415) | 69129..69891 | + | 763 | Protein_81 | plasmid SOS inhibition protein A | - |
| AUO99_RS29570 (AUO99_00420) | 69860..70048 | - | 189 | WP_001299721 | hypothetical protein | - |
| AUO99_RS29970 | 70070..70219 | + | 150 | Protein_83 | plasmid maintenance protein Mok | - |
| AUO99_RS00425 (AUO99_00425) | 70161..70286 | + | 126 | WP_001372321 | type I toxin-antitoxin system Hok family toxin | - |
| AUO99_RS29975 | 70506..70736 | + | 231 | WP_071587244 | hypothetical protein | - |
| AUO99_RS29980 (AUO99_00430) | 70734..70907 | - | 174 | Protein_86 | hypothetical protein | - |
| AUO99_RS00435 (AUO99_00435) | 71205..71492 | + | 288 | WP_000107537 | hypothetical protein | - |
| AUO99_RS00440 (AUO99_00440) | 71612..72433 | + | 822 | WP_001234469 | DUF932 domain-containing protein | - |
| AUO99_RS00445 (AUO99_00445) | 72730..73377 | - | 648 | WP_000614282 | transglycosylase SLT domain-containing protein | virB1 |
| AUO99_RS00450 (AUO99_00450) | 73663..74046 | + | 384 | WP_001151564 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| AUO99_RS00455 (AUO99_00455) | 74240..74926 | + | 687 | WP_000332487 | PAS domain-containing protein | - |
| AUO99_RS00460 (AUO99_00460) | 75020..75247 | + | 228 | WP_001254388 | conjugal transfer relaxosome protein TraY | - |
| AUO99_RS00465 (AUO99_00465) | 75281..75643 | + | 363 | WP_001098998 | type IV conjugative transfer system pilin TraA | - |
| AUO99_RS00470 (AUO99_00470) | 75648..75959 | + | 312 | WP_000012106 | type IV conjugative transfer system protein TraL | traL |
| AUO99_RS00475 (AUO99_00475) | 75981..76547 | + | 567 | WP_000399804 | type IV conjugative transfer system protein TraE | traE |
| AUO99_RS00480 (AUO99_00480) | 76534..77262 | + | 729 | WP_001230787 | type-F conjugative transfer system secretin TraK | traK |
| AUO99_RS00485 (AUO99_00485) | 77262..78689 | + | 1428 | WP_060667420 | F-type conjugal transfer pilus assembly protein TraB | traB |
| AUO99_RS00490 (AUO99_00490) | 78679..79263 | + | 585 | WP_000002795 | conjugal transfer pilus-stabilizing protein TraP | - |
| AUO99_RS00495 (AUO99_00495) | 79250..79570 | + | 321 | WP_001057302 | conjugal transfer protein TrbD | virb4 |
| AUO99_RS00500 (AUO99_00500) | 79563..79814 | + | 252 | WP_001038341 | conjugal transfer protein TrbG | - |
| AUO99_RS00505 (AUO99_00505) | 79811..80326 | + | 516 | WP_000809893 | type IV conjugative transfer system lipoprotein TraV | traV |
| AUO99_RS26475 | 80461..80682 | + | 222 | WP_001278978 | conjugal transfer protein TraR | - |
| AUO99_RS00510 (AUO99_00510) | 80842..83472 | + | 2631 | WP_012783967 | type IV secretion system protein TraC | virb4 |
| AUO99_RS00515 (AUO99_00515) | 83519..84223 | + | 705 | WP_001067855 | IS6-like element IS26 family transposase | - |
| AUO99_RS00525 (AUO99_00525) | 84467..85729 | - | 1263 | WP_000608644 | IS1380-like element ISEcp1 family transposase | - |
| AUO99_RS29015 (AUO99_00530) | 85911..86129 | - | 219 | WP_001143771 | DUF4158 domain-containing protein | - |
| AUO99_RS00535 (AUO99_00535) | 86293..86850 | + | 558 | WP_060667421 | recombinase family protein | - |
| AUO99_RS00540 (AUO99_00540) | 87033..87893 | + | 861 | WP_000027057 | broad-spectrum class A beta-lactamase TEM-1 | - |
| AUO99_RS00545 (AUO99_00545) | 88040..90511 | - | 2472 | Protein_109 | Tn3-like element TnAs3 family transposase | - |
| AUO99_RS29020 | 90514..90600 | - | 87 | Protein_110 | helix-turn-helix domain-containing protein | - |
| AUO99_RS00550 (AUO99_00550) | 90654..91358 | - | 705 | WP_001067858 | IS6-like element IS26 family transposase | - |
| AUO99_RS00555 (AUO99_00555) | 91474..91779 | + | 306 | WP_000224416 | hypothetical protein | - |
| AUO99_RS00560 (AUO99_00560) | 91788..92426 | + | 639 | WP_001080256 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| AUO99_RS00565 (AUO99_00565) | 92423..94273 | + | 1851 | WP_000821856 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| AUO99_RS00570 (AUO99_00570) | 94300..94557 | + | 258 | WP_000864353 | conjugal transfer protein TrbE | - |
| AUO99_RS00575 (AUO99_00575) | 94550..95293 | + | 744 | WP_001030371 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| AUO99_RS00580 (AUO99_00580) | 95307..95651 | + | 345 | WP_000556796 | conjugal transfer protein TrbA | - |
| AUO99_RS00585 (AUO99_00585) | 95770..96054 | + | 285 | WP_000624194 | type-F conjugative transfer system pilin chaperone TraQ | - |
| AUO99_RS00590 (AUO99_00590) | 96041..96586 | + | 546 | WP_000059831 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| AUO99_RS00595 (AUO99_00595) | 96516..96863 | + | 348 | WP_001309242 | P-type conjugative transfer protein TrbJ | - |
| AUO99_RS00600 (AUO99_00600) | 96844..97236 | + | 393 | WP_000660699 | F-type conjugal transfer protein TrbF | - |
| AUO99_RS00605 (AUO99_00605) | 97223..98596 | + | 1374 | WP_000944331 | conjugal transfer pilus assembly protein TraH | traH |
| AUO99_RS00610 (AUO99_00610) | 98593..101415 | + | 2823 | WP_001007039 | conjugal transfer mating-pair stabilization protein TraG | traG |
| AUO99_RS00615 (AUO99_00615) | 101431..101916 | + | 486 | WP_000605870 | hypothetical protein | - |
| AUO99_RS00620 (AUO99_00620) | 101965..102696 | + | 732 | WP_000782451 | conjugal transfer complement resistance protein TraT | - |
| AUO99_RS00625 (AUO99_00625) | 102899..103636 | + | 738 | WP_000199905 | hypothetical protein | - |
| AUO99_RS00630 (AUO99_00630) | 103687..105885 | + | 2199 | WP_000009332 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 1220 | GenBank | NZ_CP013657 |
| Plasmid name | puk_P46212 | Incompatibility group | IncFIA |
| Plasmid size | 143748 bp | Coordinate of oriT [Strand] | 73215..73664 [-] |
| Host baterium | Escherichia coli strain uk_P46212 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |