Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100757
Name   oriT_PDM04 in_silico
Organism   Salmonella enterica subsp. enterica serovar Anatum strain GT-38
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP013224 (75907..76009 [-], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_PDM04
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   829 GenBank   WP_001354015
Name   NikB_PDM04 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 81375..110805

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AS586_RS00425 (AS586_23815) 79091..81382 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
AS586_RS00430 (AS586_23820) 81375..82445 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
AS586_RS00435 (AS586_23825) 82464..83672 - 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
AS586_RS00440 (AS586_23830) 83964..84116 + 153 WP_001331364 Hok/Gef family protein -
AS586_RS27075 84188..84379 - 192 WP_174715448 hypothetical protein -
AS586_RS27080 84940..85035 + 96 WP_000609148 DinQ-like type I toxin DqlB -
AS586_RS26630 85100..85276 - 177 WP_001054904 hypothetical protein -
AS586_RS00450 (AS586_23840) 85668..85877 + 210 WP_000062603 HEAT repeat domain-containing protein -
AS586_RS00455 (AS586_23845) 85949..86611 - 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
AS586_RS00460 (AS586_23850) 86676..88838 - 2163 WP_000698351 DotA/TraY family protein traY
AS586_RS00465 (AS586_23855) 88935..89519 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
AS586_RS00470 (AS586_23860) 89548..90750 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
AS586_RS24205 90717..91331 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
AS586_RS00475 (AS586_23865) 91331..94375 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
AS586_RS00480 (AS586_23870) 94465..95265 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
AS586_RS00485 (AS586_23875) 95249..95437 - 189 WP_001277255 putative conjugal transfer protein TraS -
AS586_RS00490 (AS586_23880) 95501..95905 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
AS586_RS00495 (AS586_23885) 95956..96483 - 528 WP_001055569 conjugal transfer protein TraQ traQ
AS586_RS00500 (AS586_23890) 96483..97187 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
AS586_RS00505 (AS586_23895) 97187..98476 - 1290 WP_001272005 conjugal transfer protein TraO traO
AS586_RS00510 (AS586_23900) 98479..99462 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
AS586_RS00515 (AS586_23905) 99473..100165 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
AS586_RS00520 (AS586_23910) 100162..100509 - 348 WP_001055900 conjugal transfer protein traL
AS586_RS00525 (AS586_23915) 100527..104294 - 3768 WP_001141529 LPD7 domain-containing protein -
AS586_RS00530 (AS586_23920) 104384..104935 - 552 WP_000014583 phospholipase D family protein -
AS586_RS24210 104950..105240 - 291 WP_001299214 hypothetical protein traK
AS586_RS00535 (AS586_23925) 105237..106385 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
AS586_RS00540 (AS586_23930) 106382..107200 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
AS586_RS00545 (AS586_23935) 107197..107655 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
AS586_RS00550 (AS586_23940) 108050..108634 - 585 WP_000977522 histidine phosphatase family protein -
AS586_RS00555 (AS586_23945) 108694..109896 - 1203 WP_000976351 conjugal transfer protein TraF -
AS586_RS00560 (AS586_23950) 109981..110805 - 825 WP_001238939 conjugal transfer protein TraE traE
AS586_RS00565 (AS586_23955) 110956..112110 - 1155 WP_001139957 site-specific integrase -


Host bacterium


ID   1217 GenBank   NZ_CP013224
Plasmid name   PDM04 Incompatibility group   IncI1
Plasmid size   112176 bp Coordinate of oriT [Strand]   75907..76009 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Anatum strain GT-38

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -