Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100752 |
| Name | oriT_pCCGM7-A  |
| Organism | Sinorhizobium americanum CCGM7 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP013052 (80091..80147 [-], 57 nt) |
| oriT length | 57 nt |
| IRs (inverted repeats) | 4..14, 18..28 (GGAAAATGGCG..CACATTTTTCC) |
| Location of nic site | 36..37 |
| Conserved sequence flanking the nic site |
TATCCTG|C |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 57 nt
>oriT_pCCGM7-A
GCAGGAAAATGGCGTAGCACATTTTTCCGTATCCTGCCTCTCTAGATTGTAAGGGGA
GCAGGAAAATGGCGTAGCACATTTTTCCGTATCCTGCCTCTCTAGATTGTAAGGGGA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 824 | GenBank | WP_037382731 |
| Name | MobC_pCCGM7-A |
UniProt ID | A0A1L3L8I3 |
| Length | 133 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 133 a.a. Molecular weight: 14669.76 Da Isoelectric Point: 7.3220
>WP_037382731.1 plasmid mobilization relaxosome protein MobC [Sinorhizobium americanum]
MDEGKFNALLEPPKKDRTVHVRVTADEHAAIEKAAADAGMTVSSFFRSLNMEGAGVRPILTRDDRLVMAA
LLEDMRMIGINLNQVARALNSGRGVHPSELDINLENVQRVQAAVMSELRALTQRAGYQRRGET
MDEGKFNALLEPPKKDRTVHVRVTADEHAAIEKAAADAGMTVSSFFRSLNMEGAGVRPILTRDDRLVMAA
LLEDMRMIGINLNQVARALNSGRGVHPSELDINLENVQRVQAAVMSELRALTQRAGYQRRGET
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L3L8I3 |
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 108002..117926
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAMCCGM7_RS17645 (SAMCCGM7_pA0096) | 103963..104994 | + | 1032 | WP_037382045 | GlxA family transcriptional regulator | - |
| SAMCCGM7_RS17650 | 105064..105786 | + | 723 | WP_037382043 | MOSC domain-containing protein | - |
| SAMCCGM7_RS17655 (SAMCCGM7_pA0098) | 105906..108005 | - | 2100 | WP_037382041 | type IV secretory system conjugative DNA transfer family protein | - |
| SAMCCGM7_RS17660 (SAMCCGM7_pA0099) | 108002..109030 | - | 1029 | WP_037382039 | P-type DNA transfer ATPase VirB11 | virB11 |
| SAMCCGM7_RS17665 (SAMCCGM7_pA0100) | 109011..110228 | - | 1218 | WP_037382037 | type IV secretion system protein VirB10 | virB10 |
| SAMCCGM7_RS17670 (SAMCCGM7_pA0101) | 110228..111037 | - | 810 | WP_037382036 | P-type conjugative transfer protein VirB9 | virB9 |
| SAMCCGM7_RS17675 (SAMCCGM7_pA0102) | 111034..111729 | - | 696 | WP_037382034 | type IV secretion system protein | virB8 |
| SAMCCGM7_RS17680 (SAMCCGM7_pA0103) | 111755..112786 | - | 1032 | WP_037382032 | type IV secretion system protein | virB6 |
| SAMCCGM7_RS33955 | 112802..112999 | - | 198 | WP_156877958 | hypothetical protein | - |
| SAMCCGM7_RS17690 (SAMCCGM7_pA0105) | 113019..113726 | - | 708 | WP_037382030 | type IV secretion system protein | - |
| SAMCCGM7_RS17695 (SAMCCGM7_pA0106) | 113738..114826 | - | 1089 | WP_037382027 | lytic transglycosylase domain-containing protein | - |
| SAMCCGM7_RS17700 (SAMCCGM7_pA0107) | 114823..117282 | - | 2460 | WP_037382025 | VirB4 family type IV secretion/conjugal transfer ATPase | virb4 |
| SAMCCGM7_RS17705 (SAMCCGM7_pA0108) | 117285..117584 | - | 300 | WP_072597131 | VirB3 family type IV secretion system protein | virB3 |
| SAMCCGM7_RS17710 (SAMCCGM7_pA0109) | 117588..117926 | - | 339 | WP_015241462 | TrbC/VirB2 family protein | virB2 |
| SAMCCGM7_RS17715 (SAMCCGM7_pA0110) | 117938..118849 | - | 912 | WP_037382067 | lytic transglycosylase domain-containing protein | - |
| SAMCCGM7_RS17720 (SAMCCGM7_pA0111) | 119072..119680 | + | 609 | WP_037382017 | hypothetical protein | - |
| SAMCCGM7_RS17725 (SAMCCGM7_pA0112) | 119677..120213 | + | 537 | WP_037382015 | succinoglycan biosynthesis protein exoi | - |
| SAMCCGM7_RS17730 | 120210..120911 | + | 702 | WP_037382013 | thermonuclease family protein | - |
| SAMCCGM7_RS17740 | 121313..121906 | + | 594 | WP_037382011 | hypothetical protein | - |
| SAMCCGM7_RS17745 | 121929..122345 | + | 417 | WP_037382009 | hypothetical protein | - |
| SAMCCGM7_RS17750 (SAMCCGM7_pA0115) | 122428..122763 | - | 336 | WP_037382007 | hypothetical protein | - |
Host bacterium
| ID | 1212 | GenBank | NZ_CP013052 |
| Plasmid name | pCCGM7-A | Incompatibility group | _ |
| Plasmid size | 405481 bp | Coordinate of oriT [Strand] | 80091..80147 [-] |
| Host baterium | Sinorhizobium americanum CCGM7 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | putrescine degradation |
| Symbiosis gene | fixB, fixA |
| Anti-CRISPR | - |