Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100751
Name   oriT_p2009C-3133-3 in_silico
Organism   Escherichia coli strain 2009C-3133
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP013027 (79783..80072 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_p2009C-3133-3
CGCACCGCTAGCAGCGCCCCTGGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   823 GenBank   WP_000986969
Name   TraI_p2009C-3133-3 insolico UniProt ID   A0A0P0T0N6
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191917.73 Da        Isoelectric Point: 5.9718

>WP_000986969.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGKLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGNTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGRPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSNSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVSDSPFMALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKTGLHTPAQQAIHLALPVVESKNLAFSMVDLLTEAKSFAAEGTSFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLLQRSGETPNFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWVPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
APVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVQIARDNPDSGVVVRIAGE
GRPWNPGTITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVRDIAGLERDRSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

AAA domain (AAA_30)

(969-1156)

TrwC relaxase (TrwC)

(10-283)

DNA helicase TraI (TraI_C)

(1434-1557)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 79221..105333

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MJ49_RS27330 (MJ49_27290) 75212..75646 + 435 WP_000845922 conjugation system SOS inhibitor PsiB -
MJ49_RS27335 (MJ49_27295) 75643..76429 + 787 Protein_81 plasmid SOS inhibition protein A -
MJ49_RS33280 76619..76732 + 114 Protein_82 DUF5431 family protein -
MJ49_RS30305 76677..76799 + 123 WP_223195199 Hok/Gef family protein -
MJ49_RS32825 (MJ49_27300) 77100..77397 - 298 Protein_84 hypothetical protein -
MJ49_RS27350 (MJ49_27310) 77698..77985 + 288 WP_000107520 hypothetical protein -
MJ49_RS27355 (MJ49_27315) 78104..78925 + 822 WP_001234468 DUF932 domain-containing protein -
MJ49_RS27360 (MJ49_27320) 79221..79823 - 603 WP_077870411 transglycosylase SLT domain-containing protein virB1
MJ49_RS27365 (MJ49_27325) 80144..80527 + 384 WP_001151528 conjugal transfer relaxosome DNA-binding protein TraM -
MJ49_RS27370 (MJ49_27330) 80714..81403 + 690 WP_000283383 conjugal transfer transcriptional regulator TraJ -
MJ49_RS27375 (MJ49_27335) 81502..81897 + 396 WP_001366159 conjugal transfer relaxosome DNA-bindin protein TraY -
MJ49_RS27380 (MJ49_27340) 81930..82292 + 363 WP_000994784 type IV conjugative transfer system pilin TraA -
MJ49_RS27385 (MJ49_27345) 82297..82608 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
MJ49_RS27390 (MJ49_27350) 82630..83196 + 567 WP_055280219 type IV conjugative transfer system protein TraE traE
MJ49_RS27395 (MJ49_27355) 83183..83911 + 729 WP_001230805 type-F conjugative transfer system secretin TraK traK
MJ49_RS27400 (MJ49_27360) 83911..85362 + 1452 WP_000146659 F-type conjugal transfer pilus assembly protein TraB traB
MJ49_RS27405 (MJ49_27365) 85352..85912 + 561 WP_000896605 conjugal transfer pilus-stabilizing protein TraP -
MJ49_RS27410 (MJ49_27370) 85899..86219 + 321 WP_001057304 conjugal transfer protein TrbD virb4
MJ49_RS27415 (MJ49_27375) 86212..86463 + 252 WP_001038331 conjugal transfer protein TrbG -
MJ49_RS27420 (MJ49_27380) 86460..86975 + 516 WP_000809885 type IV conjugative transfer system lipoprotein TraV traV
MJ49_RS30315 87110..87331 + 222 WP_001278686 conjugal transfer protein TraR -
MJ49_RS27425 (MJ49_27385) 87491..90118 + 2628 WP_001064265 type IV secretion system protein TraC virb4
MJ49_RS27430 (MJ49_27390) 90115..90501 + 387 WP_000099693 type-F conjugative transfer system protein TrbI -
MJ49_RS27435 (MJ49_27395) 90498..91130 + 633 WP_001203750 type-F conjugative transfer system protein TraW traW
MJ49_RS27440 (MJ49_27400) 91127..92119 + 993 WP_000830835 conjugal transfer pilus assembly protein TraU traU
MJ49_RS27445 (MJ49_27405) 92128..92766 + 639 WP_000777690 type-F conjugative transfer system pilin assembly protein TrbC trbC
MJ49_RS27450 (MJ49_27410) 92763..94571 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
MJ49_RS27455 (MJ49_27415) 94598..94855 + 258 WP_000864318 conjugal transfer protein TrbE -
MJ49_RS27460 (MJ49_27420) 94848..95591 + 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
MJ49_RS27465 (MJ49_27425) 95607..95954 + 348 WP_001287910 conjugal transfer protein TrbA -
MJ49_RS27470 (MJ49_27430) 95956..96270 - 315 WP_000415566 protein ArtA -
MJ49_RS27475 (MJ49_27435) 96351..96635 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
MJ49_RS27480 (MJ49_27440) 96622..97167 + 546 WP_000059851 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
MJ49_RS27485 (MJ49_27445) 97097..97459 + 363 WP_071887286 P-type conjugative transfer protein TrbJ -
MJ49_RS27490 (MJ49_27450) 97459..98832 + 1374 WP_001517790 conjugal transfer pilus assembly protein TraH traH
MJ49_RS27495 (MJ49_27455) 98829..101651 + 2823 WP_060565203 conjugal transfer mating-pair stabilization protein TraG traG
MJ49_RS27500 (MJ49_27460) 101667..102164 + 498 WP_000605859 entry exclusion protein -
MJ49_RS27505 (MJ49_27465) 102196..102927 + 732 WP_023565183 conjugal transfer complement resistance protein TraT -
MJ49_RS27510 (MJ49_27470) 103180..105333 + 2154 WP_000009324 type IV conjugative transfer system coupling protein TraD virb4
MJ49_RS27515 (MJ49_27475) 105342..105740 - 399 WP_000911313 type II toxin-antitoxin system VapC family toxin -
MJ49_RS27520 (MJ49_27480) 105740..105967 - 228 WP_000450520 toxin-antitoxin system antitoxin VapB -

Host bacterium

ID   1211 GenBank   NZ_CP013027
Plasmid name   p2009C-3133-3 Incompatibility group   IncFIB
Plasmid size   174564 bp Coordinate of oriT [Strand]   79783..80072 [-]
Host baterium   Escherichia coli strain 2009C-3133

Cargo genes

Drug resistance gene   sitABCD, sul2, tet(B), aph(3'')-Ib, aph(6)-Id, aph(3')-Ia, blaTEM-1B
Virulence gene   espP, iucA, iucB, iucC, iutA
Metal resistance gene   yfeC
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -