Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100738
Name   oriT_pSF-468-2 in_silico
Organism   Escherichia coli strain SF-468
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP012627 (66217..66319 [+], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pSF-468-2
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   810 GenBank   WP_021520371
Name   PutativerelaxaseofpSF-468-2 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103939.37 Da        Isoelectric Point: 7.3426

>WP_021520371.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFLQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRNERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 21181..60851

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AN206_RS26760 (AN206_26855) 16243..17310 + 1068 WP_012783947 type IV pilus biogenesis lipoprotein PilL -
AN206_RS26765 (AN206_26860) 17310..17747 + 438 WP_000539807 type IV pilus biogenesis protein PilM -
AN206_RS26770 (AN206_26865) 17761..19443 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
AN206_RS26775 (AN206_26870) 19436..20731 + 1296 WP_001388364 type 4b pilus protein PilO2 -
AN206_RS26780 (AN206_26875) 20718..21170 + 453 WP_001247870 type IV pilus biogenesis protein PilP -
AN206_RS26785 (AN206_26880) 21181..22734 + 1554 WP_001492932 ATPase, T2SS/T4P/T4SS family virB11
AN206_RS26790 (AN206_26885) 22747..23844 + 1098 WP_001492931 type II secretion system F family protein -
AN206_RS26795 (AN206_26890) 23862..24476 + 615 WP_001542527 type 4 pilus major pilin -
AN206_RS26800 (AN206_26895) 24486..25046 + 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
AN206_RS26805 (AN206_26900) 25031..25687 + 657 WP_001193553 prepilin peptidase -
AN206_RS26810 (AN206_26905) 25687..26967 + 1281 Protein_27 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
AN206_RS26815 (AN206_26910) 28634..29788 + 1155 WP_001139955 site-specific integrase -
AN206_RS26820 (AN206_26915) 29939..30763 + 825 WP_001238932 conjugal transfer protein TraE traE
AN206_RS26825 (AN206_26920) 30849..32051 + 1203 WP_000976353 conjugal transfer protein TraF -
AN206_RS26830 (AN206_26925) 32111..32695 + 585 WP_000977522 histidine phosphatase family protein -
AN206_RS26835 (AN206_26930) 33089..33547 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
AN206_RS26840 (AN206_26935) 33544..34362 + 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
AN206_RS26845 (AN206_26940) 34359..35507 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
AN206_RS29310 35504..35794 + 291 WP_001299214 hypothetical protein traK
AN206_RS26850 (AN206_26945) 35809..36360 + 552 WP_000014583 phospholipase D family protein -
AN206_RS26855 (AN206_26950) 36450..40217 + 3768 WP_001141527 LPD7 domain-containing protein -
AN206_RS26860 (AN206_26955) 40235..40582 + 348 WP_001055900 conjugal transfer protein traL
AN206_RS26865 (AN206_26960) 40579..41271 + 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
AN206_RS26870 (AN206_26965) 41282..42265 + 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
AN206_RS26875 (AN206_26970) 42268..43557 + 1290 WP_042004726 conjugal transfer protein TraO traO
AN206_RS26880 (AN206_26975) 43557..44261 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
AN206_RS26885 (AN206_26980) 44261..44788 + 528 WP_001055569 conjugal transfer protein TraQ traQ
AN206_RS26890 (AN206_26985) 44839..45243 + 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
AN206_RS26895 (AN206_26990) 45307..45495 + 189 WP_001277253 putative conjugal transfer protein TraS -
AN206_RS26900 (AN206_26995) 45479..46279 + 801 WP_001164784 IncI1-type conjugal transfer protein TraT traT
AN206_RS26905 (AN206_27000) 46369..49413 + 3045 WP_001024789 IncI1-type conjugal transfer protein TraU traU
AN206_RS26910 (AN206_27005) 49413..50027 + 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
AN206_RS26915 (AN206_27010) 49994..51196 + 1203 WP_042004725 IncI1-type conjugal transfer protein TraW traW
AN206_RS26920 (AN206_27015) 51225..51809 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
AN206_RS26925 (AN206_27020) 51906..54074 + 2169 WP_000698357 DotA/TraY family protein traY
AN206_RS26930 (AN206_27025) 54148..54798 + 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
AN206_RS26935 (AN206_27030) 54870..55079 - 210 WP_000062603 HEAT repeat domain-containing protein -
AN206_RS31080 (AN206_27040) 55471..55647 + 177 WP_001054898 hypothetical protein -
AN206_RS31650 55712..55807 - 96 WP_001303310 DinQ-like type I toxin DqlB -
AN206_RS26950 (AN206_27045) 56306..56557 + 252 WP_001291964 hypothetical protein -
AN206_RS26955 (AN206_27050) 56629..56781 - 153 WP_001331364 Hok/Gef family protein -
AN206_RS26960 (AN206_27055) 57350..58336 + 987 WP_001257838 hypothetical protein -
AN206_RS26965 (AN206_27060) 58554..59762 + 1209 WP_001383960 IncI1-type conjugal transfer protein TrbA trbA
AN206_RS26970 (AN206_27065) 59781..60851 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
AN206_RS26975 (AN206_27070) 60844..63135 + 2292 WP_021520372 F-type conjugative transfer protein TrbC -


Host bacterium


ID   1198 GenBank   NZ_CP012627
Plasmid name   pSF-468-2 Incompatibility group   IncI1
Plasmid size   92766 bp Coordinate of oriT [Strand]   66217..66319 [+]
Host baterium   Escherichia coli strain SF-468

Cargo genes


Drug resistance gene   blaCTX-M-14
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -