Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100729 |
| Name | oriT_pKPC_CAV1741 |
| Organism | Citrobacter freundii strain CAV1741 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP011656 (92577..92681 [+], 105 nt) |
| oriT length | 105 nt |
| IRs (inverted repeats) | 18..35, 42..59 (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 105 nt
>oriT_pKPC_CAV1741
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 801 | GenBank | WP_004206924 |
| Name | PutativerelaxaseofpKPC_CAV1741 |
UniProt ID | _ |
| Length | 659 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 659 a.a. Molecular weight: 75087.84 Da Isoelectric Point: 10.0285
>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 15266..26858
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB183_RS01465 (AB183_01465) | 10645..11472 | - | 828 | WP_020316842 | ParB N-terminal domain-containing protein | - |
| AB183_RS01470 (AB183_01470) | 11475..13460 | - | 1986 | WP_020316825 | hypothetical protein | - |
| AB183_RS01475 (AB183_01475) | 14538..15251 | + | 714 | WP_020316827 | hypothetical protein | - |
| AB183_RS01480 (AB183_01480) | 15266..16288 | + | 1023 | WP_020316829 | ATPase, T2SS/T4P/T4SS family | virB11 |
| AB183_RS01490 (AB183_01490) | 16987..17262 | + | 276 | WP_002353183 | hypothetical protein | - |
| AB183_RS01495 (AB183_01495) | 17269..17628 | + | 360 | WP_002353162 | hypothetical protein | - |
| AB183_RS01500 (AB183_01500) | 17641..20220 | + | 2580 | WP_032420234 | VirB4 family type IV secretion system protein | virb4 |
| AB183_RS01505 (AB183_01505) | 20217..21029 | + | 813 | WP_020316841 | hypothetical protein | - |
| AB183_RS01510 (AB183_01510) | 21029..21487 | + | 459 | WP_032420232 | hypothetical protein | - |
| AB183_RS01515 (AB183_01515) | 21534..22508 | + | 975 | WP_020316822 | type IV secretion system protein | virB6 |
| AB183_RS01520 (AB183_01520) | 22519..23244 | + | 726 | WP_020316826 | VirB8/TrbF family protein | virB8 |
| AB183_RS01525 (AB183_01525) | 23249..24082 | + | 834 | WP_032420230 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| AB183_RS01530 (AB183_01530) | 24085..25461 | + | 1377 | WP_020316837 | TrbI/VirB10 family protein | virB10 |
| AB183_RS27940 (AB183_01535) | 25442..25978 | + | 537 | WP_002353202 | hypothetical protein | tfc2 |
| AB183_RS01540 (AB183_01540) | 25984..26175 | + | 192 | WP_002396882 | membrane lipoprotein lipid attachment site-containing protein | - |
| AB183_RS01545 (AB183_01545) | 26172..26858 | + | 687 | WP_032420226 | lytic transglycosylase domain-containing protein | virB1 |
| AB183_RS01550 (AB183_01550) | 26859..27209 | + | 351 | WP_043053774 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| AB183_RS01555 (AB183_01555) | 27251..27463 | + | 213 | Protein_35 | single-stranded DNA-binding protein SSB1 | - |
| AB183_RS01560 (AB183_01560) | 27530..29608 | - | 2079 | Protein_36 | Tn3-like element Tn3 family transposase | - |
| AB183_RS01565 (AB183_01565) | 29963..31282 | + | 1320 | WP_004152397 | IS1182-like element ISKpn6 family transposase | - |
Region 2: 95479..113148
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB183_RS01935 (AB183_01935) | 90563..90874 | + | 312 | WP_004187333 | hypothetical protein | - |
| AB183_RS01940 (AB183_01940) | 91007..91543 | + | 537 | WP_004206920 | hypothetical protein | - |
| AB183_RS01945 (AB183_01945) | 92044..92409 | - | 366 | WP_004206922 | hypothetical protein | - |
| AB183_RS01950 (AB183_01950) | 92685..93002 | + | 318 | WP_004206923 | plasmid mobilization protein MobA | - |
| AB183_RS01955 (AB183_01955) | 92989..94968 | + | 1980 | WP_004206924 | TraI/MobA(P) family conjugative relaxase | - |
| AB183_RS01960 (AB183_01960) | 94982..95482 | + | 501 | WP_004206925 | DotD/TraH family lipoprotein | - |
| AB183_RS01965 (AB183_01965) | 95479..96258 | + | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| AB183_RS01970 (AB183_01970) | 96269..97432 | + | 1164 | WP_004206926 | plasmid transfer ATPase TraJ | virB11 |
| AB183_RS01975 (AB183_01975) | 97422..97682 | + | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| AB183_RS28400 | 97707..101012 | + | 3306 | WP_219818010 | LPD7 domain-containing protein | - |
| AB183_RS26015 | 100978..101490 | + | 513 | WP_011091071 | hypothetical protein | traL |
| AB183_RS01990 (AB183_01990) | 101491..101703 | - | 213 | WP_305953721 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| AB183_RS01995 (AB183_01995) | 101675..102085 | - | 411 | WP_004187465 | H-NS family nucleoid-associated regulatory protein | - |
| AB183_RS02000 (AB183_02000) | 102153..102866 | + | 714 | WP_223294958 | DotI/IcmL family type IV secretion protein | traM |
| AB183_RS02005 (AB183_02005) | 102875..104026 | + | 1152 | WP_015062843 | DotH/IcmK family type IV secretion protein | traN |
| AB183_RS02010 (AB183_02010) | 104038..105387 | + | 1350 | WP_004206932 | conjugal transfer protein TraO | traO |
| AB183_RS02015 (AB183_02015) | 105399..106103 | + | 705 | WP_004206933 | conjugal transfer protein TraP | traP |
| AB183_RS02020 (AB183_02020) | 106127..106657 | + | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
| AB183_RS02025 (AB183_02025) | 106674..107063 | + | 390 | WP_011154472 | DUF6750 family protein | traR |
| AB183_RS02030 (AB183_02030) | 107109..107603 | + | 495 | WP_004187480 | hypothetical protein | - |
| AB183_RS02035 (AB183_02035) | 107600..110650 | + | 3051 | WP_011154474 | conjugative transfer protein | traU |
| AB183_RS02040 (AB183_02040) | 110647..111855 | + | 1209 | WP_004187486 | conjugal transfer protein TraW | traW |
| AB183_RS02045 (AB183_02045) | 111852..112502 | + | 651 | WP_004187488 | hypothetical protein | - |
| AB183_RS28710 | 112618..113028 | + | 411 | Protein_133 | DotA/TraY family protein | - |
| AB183_RS02055 (AB183_02055) | 113105..115183 | - | 2079 | Protein_134 | Tn3-like element Tn3 family transposase | - |
| AB183_RS02060 (AB183_02060) | 115538..116857 | + | 1320 | WP_004152397 | IS1182-like element ISKpn6 family transposase | - |
| AB183_RS02065 (AB183_02065) | 117107..117988 | - | 882 | WP_004199234 | carbapenem-hydrolyzing class A beta-lactamase KPC-2 | - |
Region 3: 95479..111855
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB183_RS01935 (AB183_01935) | 90563..90874 | + | 312 | WP_004187333 | hypothetical protein | - |
| AB183_RS01940 (AB183_01940) | 91007..91543 | + | 537 | WP_004206920 | hypothetical protein | - |
| AB183_RS01945 (AB183_01945) | 92044..92409 | - | 366 | WP_004206922 | hypothetical protein | - |
| AB183_RS01950 (AB183_01950) | 92685..93002 | + | 318 | WP_004206923 | plasmid mobilization protein MobA | - |
| AB183_RS01955 (AB183_01955) | 92989..94968 | + | 1980 | WP_004206924 | TraI/MobA(P) family conjugative relaxase | - |
| AB183_RS01960 (AB183_01960) | 94982..95482 | + | 501 | WP_004206925 | DotD/TraH family lipoprotein | - |
| AB183_RS01965 (AB183_01965) | 95479..96258 | + | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| AB183_RS01970 (AB183_01970) | 96269..97432 | + | 1164 | WP_004206926 | plasmid transfer ATPase TraJ | virB11 |
| AB183_RS01975 (AB183_01975) | 97422..97682 | + | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| AB183_RS28400 | 97707..101012 | + | 3306 | WP_219818010 | LPD7 domain-containing protein | - |
| AB183_RS26015 | 100978..101490 | + | 513 | WP_011091071 | hypothetical protein | traL |
| AB183_RS01990 (AB183_01990) | 101491..101703 | - | 213 | WP_305953721 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| AB183_RS01995 (AB183_01995) | 101675..102085 | - | 411 | WP_004187465 | H-NS family nucleoid-associated regulatory protein | - |
| AB183_RS02000 (AB183_02000) | 102153..102866 | + | 714 | WP_223294958 | DotI/IcmL family type IV secretion protein | traM |
| AB183_RS02005 (AB183_02005) | 102875..104026 | + | 1152 | WP_015062843 | DotH/IcmK family type IV secretion protein | traN |
| AB183_RS02010 (AB183_02010) | 104038..105387 | + | 1350 | WP_004206932 | conjugal transfer protein TraO | traO |
| AB183_RS02015 (AB183_02015) | 105399..106103 | + | 705 | WP_004206933 | conjugal transfer protein TraP | traP |
| AB183_RS02020 (AB183_02020) | 106127..106657 | + | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
| AB183_RS02025 (AB183_02025) | 106674..107063 | + | 390 | WP_011154472 | DUF6750 family protein | traR |
| AB183_RS02030 (AB183_02030) | 107109..107603 | + | 495 | WP_004187480 | hypothetical protein | - |
| AB183_RS02035 (AB183_02035) | 107600..110650 | + | 3051 | WP_011154474 | conjugative transfer protein | traU |
| AB183_RS02040 (AB183_02040) | 110647..111855 | + | 1209 | WP_004187486 | conjugal transfer protein TraW | traW |
| AB183_RS02045 (AB183_02045) | 111852..112502 | + | 651 | WP_004187488 | hypothetical protein | - |
| AB183_RS28710 | 112618..113028 | + | 411 | Protein_133 | DotA/TraY family protein | - |
| AB183_RS02055 (AB183_02055) | 113105..115183 | - | 2079 | Protein_134 | Tn3-like element Tn3 family transposase | - |
Host bacterium
| ID | 1189 | GenBank | NZ_CP011656 |
| Plasmid name | pKPC_CAV1741 | Incompatibility group | IncL/M(pMU407) |
| Plasmid size | 129196 bp | Coordinate of oriT [Strand] | 92577..92681 [+] |
| Host baterium | Citrobacter freundii strain CAV1741 |
Cargo genes
| Drug resistance gene | blaKPC-2, blaTEM-1B, ant(3'')-Ia, qacE, sul1, blaSHV-30 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |