Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100727
Name   oriT_pCAV1492-73 in_silico
Organism   Serratia marcescens strain CAV1492
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP011640 (57154..57258 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pCAV1492-73
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   799 GenBank   WP_004206924
Name   PutativerelaxaseofpCAV1492-73 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 60056..71640

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AB188_RS00740 (AB188_00745) 55140..55451 + 312 WP_004187333 hypothetical protein -
AB188_RS00745 (AB188_00750) 55584..56120 + 537 WP_004206920 hypothetical protein -
AB188_RS00750 (AB188_00755) 56621..56986 - 366 WP_004206922 hypothetical protein -
AB188_RS00755 (AB188_00760) 57262..57579 + 318 WP_004206923 plasmid mobilization protein MobA -
AB188_RS00760 (AB188_00765) 57566..59545 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
AB188_RS00765 (AB188_00770) 59559..60059 + 501 WP_004206925 DotD/TraH family lipoprotein -
AB188_RS00770 (AB188_00775) 60056..60835 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
AB188_RS00775 (AB188_00780) 60846..62009 + 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
AB188_RS00780 (AB188_00785) 61999..62259 + 261 WP_004187310 IcmT/TraK family protein traK
AB188_RS29865 62284..65589 + 3306 WP_219818010 LPD7 domain-containing protein -
AB188_RS27735 65555..66067 + 513 WP_011091071 hypothetical protein traL
AB188_RS27740 66068..66280 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
AB188_RS00790 (AB188_00795) 66252..66662 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AB188_RS00795 (AB188_00800) 66730..67443 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AB188_RS27745 (AB188_00805) 67452..68603 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AB188_RS00805 (AB188_00810) 68615..69964 + 1350 WP_004206932 conjugal transfer protein TraO traO
AB188_RS00810 (AB188_00815) 69976..70680 + 705 WP_004206933 conjugal transfer protein TraP traP
AB188_RS00815 (AB188_00820) 70704..71234 + 531 WP_004187478 conjugal transfer protein TraQ traQ
AB188_RS00820 (AB188_00825) 71251..71640 + 390 WP_011154472 DUF6750 family protein traR
AB188_RS00825 (AB188_00830) 71686..72180 + 495 WP_004187480 hypothetical protein -

Host bacterium

ID   1187 GenBank   NZ_CP011640
Plasmid name   pCAV1492-73 Incompatibility group   IncL/M
Plasmid size   73100 bp Coordinate of oriT [Strand]   57154..57258 [+]
Host baterium   Serratia marcescens strain CAV1492

Cargo genes

Drug resistance gene   blaSHV-30
Virulence gene   -
Metal resistance gene   merE, merD, merA, merC, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -