Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100721
Name   oriT_pCAV1321-71 in_silico
Organism   Citrobacter freundii strain CAV1321
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP011609 (57505..57609 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pCAV1321-71
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   793 GenBank   WP_004206924
Name   PutativerelaxaseofpCAV1321-71 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 60407..70315

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AB180_RS00725 (AB180_00725) 55491..55802 + 312 WP_004187333 hypothetical protein -
AB180_RS00730 (AB180_00730) 55935..56471 + 537 WP_004206920 hypothetical protein -
AB180_RS00735 (AB180_00735) 56972..57337 - 366 WP_004206922 hypothetical protein -
AB180_RS00740 (AB180_00740) 57613..57930 + 318 WP_004206923 plasmid mobilization protein MobA -
AB180_RS00745 (AB180_00745) 57917..59896 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
AB180_RS00750 (AB180_00750) 59910..60410 + 501 WP_004206925 DotD/TraH family lipoprotein -
AB180_RS00755 (AB180_00755) 60407..61186 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
AB180_RS00760 (AB180_00760) 61197..62360 + 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
AB180_RS00765 (AB180_00765) 62350..62610 + 261 WP_004187310 IcmT/TraK family protein traK
AB180_RS28990 62635..65940 + 3306 WP_219818010 LPD7 domain-containing protein -
AB180_RS26520 65906..66418 + 513 WP_011091071 hypothetical protein traL
AB180_RS00780 (AB180_00780) 66419..66631 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
AB180_RS00785 (AB180_00785) 66603..67013 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AB180_RS00790 (AB180_00790) 67081..67794 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AB180_RS00795 (AB180_00795) 67803..68954 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AB180_RS00800 (AB180_00800) 68966..70315 + 1350 WP_004206932 conjugal transfer protein TraO traO

Host bacterium

ID   1181 GenBank   NZ_CP011609
Plasmid name   pCAV1321-71 Incompatibility group   IncL/M
Plasmid size   70610 bp Coordinate of oriT [Strand]   57505..57609 [+]
Host baterium   Citrobacter freundii strain CAV1321

Cargo genes

Drug resistance gene   ant(3'')-Ia, qacE, sul1, blaSHV-30
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -