Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100716
Name   oriT_pCAV1099-69 in_silico
Organism   Klebsiella oxytoca strain CAV1099
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NZ_CP011593 (22980..23084 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_pCAV1099-69
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   788 GenBank   WP_004206924
Name   PutativerelaxaseofpCAV1099-69 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75087.84 Da        Isoelectric Point: 10.0285

>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 25882..45078

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AB184_RS00230 (AB184_00230) 20966..21277 + 312 WP_004187333 hypothetical protein -
AB184_RS00235 (AB184_00235) 21410..21946 + 537 WP_004206920 hypothetical protein -
AB184_RS00240 (AB184_00240) 22447..22812 - 366 WP_004206922 hypothetical protein -
AB184_RS00245 (AB184_00245) 23088..23405 + 318 WP_004206923 plasmid mobilization protein MobA -
AB184_RS00250 (AB184_00250) 23392..25371 + 1980 WP_004206924 TraI/MobA(P) family conjugative relaxase -
AB184_RS00255 (AB184_00255) 25385..25885 + 501 WP_004206925 DotD/TraH family lipoprotein -
AB184_RS00260 (AB184_00260) 25882..26661 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
AB184_RS00265 (AB184_00265) 26672..27835 + 1164 WP_004206926 plasmid transfer ATPase TraJ virB11
AB184_RS00270 (AB184_00270) 27825..28085 + 261 WP_004187310 IcmT/TraK family protein traK
AB184_RS34285 28110..31415 + 3306 WP_227516140 LPD7 domain-containing protein -
AB184_RS31450 31381..31893 + 513 WP_011091071 hypothetical protein traL
AB184_RS00285 (AB184_00285) 31894..32106 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
AB184_RS00290 (AB184_00290) 32078..32488 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
AB184_RS00295 (AB184_00295) 32556..33269 + 714 WP_223294958 DotI/IcmL family type IV secretion protein traM
AB184_RS31575 (AB184_00305) 33278..34429 + 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
AB184_RS00310 (AB184_00310) 34441..35790 + 1350 WP_004206932 conjugal transfer protein TraO traO
AB184_RS00315 (AB184_00315) 35802..36506 + 705 WP_004206933 conjugal transfer protein TraP traP
AB184_RS00320 (AB184_00320) 36530..37060 + 531 WP_004187478 conjugal transfer protein TraQ traQ
AB184_RS00325 (AB184_00325) 37077..37466 + 390 WP_011154472 DUF6750 family protein traR
AB184_RS00330 (AB184_00330) 37512..38006 + 495 WP_004187480 hypothetical protein -
AB184_RS00335 (AB184_00335) 38003..41053 + 3051 WP_011154474 conjugative transfer protein traU
AB184_RS00340 (AB184_00340) 41050..42258 + 1209 WP_004187486 conjugal transfer protein TraW traW
AB184_RS00345 (AB184_00345) 42255..42905 + 651 WP_004187488 hypothetical protein -
AB184_RS00350 (AB184_00350) 42898..45078 + 2181 WP_004187492 DotA/TraY family protein traY
AB184_RS00355 (AB184_00355) 45081..45734 + 654 WP_004206935 hypothetical protein -
AB184_RS00360 (AB184_00360) 45808..46038 + 231 WP_004187496 IncL/M type plasmid replication protein RepC -
AB184_RS00365 (AB184_00365) 46335..47390 + 1056 WP_015062846 plasmid replication initiator RepA -
AB184_RS00370 (AB184_00370) 48562..49095 - 534 Protein_65 IS110-like element IS4321 family transposase -

Host bacterium

ID   1176 GenBank   NZ_CP011593
Plasmid name   pCAV1099-69 Incompatibility group   IncL/M
Plasmid size   68910 bp Coordinate of oriT [Strand]   22980..23084 [+]
Host baterium   Klebsiella oxytoca strain CAV1099

Cargo genes

Drug resistance gene   ant(2'')-Ia, aadA6, blaOXA-2, qacE, sul1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -