Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100707
Name   oriT_pVR50D in_silico
Organism   Escherichia coli VR50
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP011138 (866..949 [-], 84 nt)
oriT length   84 nt
IRs (inverted repeats)      3..12, 16..25  (GTGTCGGGGC..GCCCTGACCC)
Location of nic site      56..57
Conserved sequence flanking the
  nic site  
 
 CTGG|CTTA
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 84 nt

>oriT_pVR50D
GGGGTGTCGGGGCGAAGCCCTGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTAACCATTCGGCATCAGTGCGGATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   779 GenBank   WP_046072959
Name   MobC_pVR50D insolico UniProt ID   _
Length   107 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 107 a.a.        Molecular weight: 11802.66 Da        Isoelectric Point: 9.6384

>WP_046072959.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Gammaproteobacteria]
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLCQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS

  Protein domains


Predicted by InterproScan.

(51-94)


  Protein structure



No available structure.




Host bacterium


ID   1167 GenBank   NZ_CP011138
Plasmid name   pVR50D Incompatibility group   ColRNAI
Plasmid size   5631 bp Coordinate of oriT [Strand]   866..949 [-]
Host baterium   Escherichia coli VR50

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -